Property Summary

NCBI Gene PubMed Count 34
Grant Count 24
R01 Count 14
Funding $1,185,958.94
PubMed Score 39.52
PubTator Score 36.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Gene RIF (17)

PMID Text
26103003 MiR-34a was down-regulated in colorectal cancer cells and inversely correlated with FMNL2 and E2F5 expressions. Our study suggests that miR-34a is an important tumor suppressor of CRC progression by targeting FMNL2 and E2F5.
25422988 miR-98 regulates muscle differentiation by altering the expression of the transcription factor E2F5 and, in turn, of multiple E2F5 targets.
24529171 In hepatocellular carcinoma cells hepatitis B virus down-regulates E2F5 expression by up-regulating expression of miR-181a.
24324077 expression of E2F5 in esphageal squamous cell cancer (ESCC) may be correlated with a worse prognosis of patients with ESCC
23377984 E2F5 may be a novel potential candidate marker for malignant prostate cancer
21274376 Data indicate that E2F5 is commonly overexpressed in primary hepatocellular carcinomas and show that E2F5 knockdown significantly repressed the growth of HCC cells.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20639900 Diverting the function of E2F5 from a cell-cycle repressor into an activator might contribute to the higher oncogenic potential of HPV18 when compared with other high-risk HPV types.
20181230 cell-cycle regulatory protein E2F5 might play a significant role in epithelial ovarian cancer pathogenesis
19738611 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAAAEPASSGQQAPAGQGQGQRPPPQPPQAQAPQPPPPPQLGGAGGGSSRHEKSLGLLTTKFVSLLQEAK      1 - 70
DGVLDLKAAADTLAVRQKRRIYDITNVLEGIDLIEKKSKNSIQWKGVGAGCNTKEVIDRLRYLKAEIEDL     71 - 140
ELKERELDQQKLWLQQSIKNVMDDSINNRFSYVTHEDICNCFNGDTLLAIQAPSGTQLEVPIPEMGQNGQ    141 - 210
KKYQINLKSHSGPIHVLLINKESSSSKPVVFPVPPPDDLTQPSSQSLTPVTPQKSSMATQNLPEQHVSER    211 - 280
SQALQQTSATDISSAGSISGDIIDELMSSDVFPLLRLSPTPADDYNFNLDDNEGVCDLFDVQILNY        281 - 346
//

Text Mined References (36)

PMID Year Title
26103003 2015 MicroRNA-34a targets FMNL2 and E2F5 and suppresses the progression of colorectal cancer.
25422988 2015 miR-98 delays skeletal muscle differentiation by down-regulating E2F5.
24535457 2014 A genome-wide association meta-analysis of plasma A? peptides concentrations in the elderly.
24529171 2014 Up-regulated MicroRNA-181a induces carcinogenesis in hepatitis B virus-related hepatocellular carcinoma by targeting E2F5.
24324077 2013 E2F5 as an independent prognostic factor in esophageal squamous cell carcinoma.
23377984 2013 Analysis of genetic aberrations on chromosomal region 8q21-24 identifies E2F5 as an oncogene with copy number gain in prostate cancer.
21274376 2011 A potential oncogenic role of the commonly observed E2F5 overexpression in hepatocellular carcinoma.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20639900 2010 The E2F5 repressor is an activator of E6/E7 transcription and of the S-phase entry in HPV18-associated cells.
20181230 2010 E2F5 status significantly improves malignancy diagnosis of epithelial ovarian cancer.
More...