Property Summary

NCBI Gene PubMed Count 38
PubMed Score 44.20
PubTator Score 36.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease 1.101 2.0e-02
adult high grade glioma 1.100 4.8e-03
Astrocytoma, Pilocytic 1.600 7.6e-07
atypical teratoid / rhabdoid tumor 2.400 9.9e-08
ductal carcinoma in situ 1.100 4.2e-03
ependymoma 2.700 4.7e-18
glioblastoma 2.000 1.5e-08
group 3 medulloblastoma 2.300 2.5e-05
invasive ductal carcinoma 2.100 3.4e-03
lung cancer 1.200 1.2e-02
lung carcinoma 1.500 1.1e-17
malignant mesothelioma 2.400 8.3e-08
medulloblastoma, large-cell 1.100 1.0e-03
primary Sjogren syndrome 1.200 1.3e-03
primitive neuroectodermal tumor 2.200 9.0e-05
ulcerative colitis 1.200 3.2e-06

Protein-protein Interaction (4)

Gene RIF (21)

AA Sequence

MAAAEPASSGQQAPAGQGQGQRPPPQPPQAQAPQPPPPPQLGGAGGGSSRHEKSLGLLTTKFVSLLQEAK      1 - 70
DGVLDLKAAADTLAVRQKRRIYDITNVLEGIDLIEKKSKNSIQWKGVGAGCNTKEVIDRLRYLKAEIEDL     71 - 140
ELKERELDQQKLWLQQSIKNVMDDSINNRFSYVTHEDICNCFNGDTLLAIQAPSGTQLEVPIPEMGQNGQ    141 - 210
KKYQINLKSHSGPIHVLLINKESSSSKPVVFPVPPPDDLTQPSSQSLTPVTPQKSSMATQNLPEQHVSER    211 - 280
SQALQQTSATDISSAGSISGDIIDELMSSDVFPLLRLSPTPADDYNFNLDDNEGVCDLFDVQILNY        281 - 346
//

Text Mined References (40)

PMID Year Title