Property Summary

NCBI Gene PubMed Count 36
Grant Count 18
R01 Count 10
Funding $1,509,950.59
PubMed Score 58.16
PubTator Score 37.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 3.100 0.000
cystic fibrosis -3.572 0.000
Amyotrophic Lateral Sclerosis 2.619 0.000
lung cancer -4.500 0.000
lung adenocarcinoma -3.600 0.000
lung carcinoma -3.700 0.000
non-small cell lung carcinoma -3.300 0.000

Gene RIF (32)

PMID Text
25961010 The association of ANKRD1 with antiapoptotic response suggests its role as myocyte survival factor during late stage heart disease, warranting further studies on ANKRD1 during end-stage heart failure.
25585647 To the Ankrd1, it is not responsive to the cardiotoxic drug Doxorubicin, suggesting that different mechanisms govern their expression in cardiac cells.
25125175 Report structure activity relationships for ANKRD1.
24531715 ANKRD1 has a significant role in the regulation of apoptosis in human ovarian cancer cells
24162774 HIV-1 gp120 upregulates the expression of ankyrin repeat domain 1 (ANKRD1) in human B cells
23572067 Report impact of ANKRD1 mutations associated with hypertrophic cardiomyopathy on contraction parameters of engineered heart tissue.
22892129 the 26S proteasome is the dominant regulator of Ankrd1/CARP degradation, and that Ankrd1/CARP half-life is significantly longer in cardiomyocytes (h) than endothelial cells (min).
22185618 Although analyzed in a limited number of patients, there is a considerable body of evidence that MARP proteins could be suitable candidates for prognostic and diagnostic biomarkers.
22085644 Ankrd1 and desmin may play important roles in airway smooth muscle cell homeostasis.
20860623 CARP and its regulator calpain 3 appear to occupy a central position in the important cell fate-governing NF-kappaB pathway in skeletal muscle
More...

AA Sequence

MMVLKVEELVTGKKNGNGEAGEFLPEDFRDGEYEAAVTLEKQEDLKTLLAHPVTLGEQQWKSEKQREAEL      1 - 70
KKKKLEQRSKLENLEDLEIIIQLKKRKKYRKTKVPVVKEPEPEIITEPVDVPTFLKAALENKLPVVEKFL     71 - 140
SDKNNPDVCDEYKRTALHRACLEGHLAIVEKLMEAGAQIEFRDMLESTAIHWASRGGNLDVLKLLLNKGA    141 - 210
KISARDKLLSTALHVAVRTGHYECAEHLIACEADLNAKDREGDTPLHDAVRLNRYKMIRLLIMYGADLNI    211 - 280
KNCAGKTPMDLVLHWQNGTKAIFDSLRENSYKTSRIATF                                   281 - 319
//

Text Mined References (35)

PMID Year Title
25961010 2015 Induction of Ankrd1 in Dilated Cardiomyopathy Correlates with the Heart Failure Progression.
25585647 2015 Profiling of skeletal muscle Ankrd2 protein in human cardiac tissue and neonatal rat cardiomyocytes.
25125175 2014 Probing muscle ankyrin-repeat protein (MARP) structure and function.
24531715 2015 Inhibition of ANKRD1 sensitizes human ovarian cancer cells to endoplasmic reticulum stress-induced apoptosis.
23572067 2013 Impact of ANKRD1 mutations associated with hypertrophic cardiomyopathy on contraction parameters of engineered heart tissue.
22892129 2012 26S proteasome regulation of Ankrd1/CARP in adult rat ventricular myocytes and human microvascular endothelial cells.
22185618 Muscle ankyrin repeat proteins: their role in striated muscle function in health and disease.
22085644 2012 Loss of desmin triggers mechanosensitivity and up-regulation of Ankrd1 expression through Akt-NF-?B signaling pathway in smooth muscle cells.
20860623 2010 A new pathway encompassing calpain 3 and its newly identified substrate cardiac ankyrin repeat protein is involved in the regulation of the nuclear factor-?B pathway in skeletal muscle.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
More...