Property Summary

NCBI Gene PubMed Count 28
Grant Count 11
R01 Count 9
Funding $1,508,309.18
PubMed Score 32.01
PubTator Score 29.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
ependymoma 1.100 0.017
oligodendroglioma 1.400 0.002
psoriasis -2.100 0.000
glioblastoma -1.200 0.001
atypical teratoid / rhabdoid tumor 1.100 0.001
medulloblastoma, large-cell -1.100 0.001
ulcerative colitis -1.111 0.023
adult high grade glioma -1.100 0.000
group 4 medulloblastoma 1.100 0.034
aldosterone-producing adenoma -1.271 0.033
Pick disease -1.100 0.000
progressive supranuclear palsy -1.300 0.006
Breast cancer -1.200 0.000
ovarian cancer -1.800 0.000
Down syndrome 1.200 0.007

Gene RIF (16)

PMID Text
26608508 In this study, we show that this translocation results in an in-frame translocation fusing exon 12 of the tumor suppressor gene ZMYND11 to exon 3 of the chromatin protein MBTD1, encoding a protein of 1,054 amino acids
25263594 this study identifies an H3.3K36me3-specific reader and a regulator of intron retention and reveals that BS69 connects histone H3.3K36me3 to regulated RNA splicing, providing significant, important insights into chromatin regulation of pre-mRNA processing.
24795016 ZMYND11 represses gene expression by binding H3.3K36me3 and preventing transcription elongation.
24675531 We propose that BS69 specifically associates with H3K36me3-enriched chromatin through the PWWP domain, which facilitates the recruitment of MYND-bound transcription and chromatin remodeling factors
24590075 identification of ZMYND11 as an H3.3-specific reader of H3K36me3 that links the histone-variant-mediated transcription elongation control to tumor suppression
20732415 BRAM1 acts as a negative signal regulator located at the very proximal end of lymphotoxin beta receptor complex assembly.
20425112 Data show significant association between the copy number variations of BS69 and some hematological malignancies.
20138174 Data found that BS69 directly interacted with TRAF3, a negative regulator of NF-kappaB activation. Results revealed that TRAF3 was involved in the BS69-mediated suppression of LMP1/CTAR1-induced NF-kappaB activation.
19795416 Knockdown of BS69 resulted in a decrease of IFN-beta induction, suggesting that BS69 is a positive regulator for the TLR3-TICAM-1 pathway and negative regulatory properties in NF-kappaB activation.
19766626 BS69 forms oligomers. The PHD and MYND domains are important for the cellular localization of BS69. PIAS1 and Ubc9 interact with BS69 and promote the sumoylation of BS69. BS69 plays inhibitory roles in both muscle and neuron differentiation.
More...

AA Sequence

MARLTKRRQADTKAIQHLWAAIEIIRNQKQIANIDRITKYMSRVHGMHPKETTRQLSLAVKDGLIVETLT      1 - 70
VGCKGSKAGIEQEGYWLPGDEIDWETENHDWYCFECHLPGEVLICDLCFRVYHSKCLSDEFRLRDSSSPW     71 - 140
QCPVCRSIKKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKY    141 - 210
RSYEEFKADAQLLLHNTVIFYGADSEQADIARMLYKDTCHELDELQLCKNCFYLSNARPDNWFCYPCIPN    211 - 280
HELVWAKMKGFGFWPAKVMQKEDNQVDVRFFGHHHQRAWIPSENIQDITVNIHRLHVKRSMGWKKACDEL    281 - 350
ELHQRFLREGRFWKSKNEDRGEEEAESSISSTSNEQLKVTQEPRAKKGRRNQSVEPKKEEPEPETEAVSS    351 - 420
SQEIPTMPQPIEKVSVSTQTKKLSASSPRMLHRSTQTTNDGVCQSMCHDKYTKIFNDFKDRMKSDHKRET    421 - 490
ERVVREALEKLRSEMEEEKRQAVNKAVANMQGEMDRKCKQVKEKCKEEFVEEIKKLATQHKQLISQTKKK    491 - 560
QWCYNCEEEAMYHCCWNTSYCSIKCQQEHWHAEHKRTCRRKR                                561 - 602
//

Text Mined References (42)

PMID Year Title
26608508 2016 Recurrent translocation t(10;17)(p15;q21) in minimally differentiated acute myeloid leukemia results in ZMYND11/MBTD1 fusion.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25263594 2014 BS69/ZMYND11 reads and connects histone H3.3 lysine 36 trimethylation-decorated chromatin to regulated pre-mRNA processing.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25217958 2014 Refining analyses of copy number variation identifies specific genes associated with developmental delay.
24795016 2014 The putative tumor suppressor ZMYND11 recognizes H3.3K36me3.
24675531 2014 Crystal structure of human BS69 Bromo-ZnF-PWWP reveals its role in H3K36me3 nucleosome binding.
24590075 2014 ZMYND11 links histone H3.3K36me3 to transcription elongation and tumour suppression.
23915195 2014 Recurrent translocation (10;17)(p15;q21) in acute poorly differentiated myeloid leukemia likely results in ZMYND11-MBTD1 fusion.
23372760 2013 Structural and functional analysis of the DEAF-1 and BS69 MYND domains.
More...