Property Summary

NCBI Gene PubMed Count 32
PubMed Score 58.88
PubTator Score 38.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Deafness, Autosomal Dominant 15 1 0.0 0.0
Disease Target Count P-value
psoriasis 6694 4.3e-08
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 5.802 2.9
Disease Target Count Z-score Confidence
Sensorineural hearing loss 106 3.762 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.400 4.3e-08

Gene RIF (22)

AA Sequence

MMAMNSKQPFGMHPVLQEPKFSSLHSGSEAMRRVCLPAPQLQGNIFGSFDESLLARAEALAAVDIVSHGK      1 - 70
NHPFKPDATYHTMSSVPCTSTSSTVPISHPAALTSHPHHAVHQGLEGDLLEHISPTLSVSGLGAPEHSVM     71 - 140
PAQIHPHHLGAMGHLHQAMGMSHPHTVAPHSAMPACLSDVESDPRELEAFAERFKQRRIKLGVTQADVGA    141 - 210
ALANLKIPGVGSLSQSTICRFESLTLSHNNMIALKPVLQAWLEEAEAAYREKNSKPELFNGSERKRKRTS    211 - 280
IAAPEKRSLEAYFAIQPRPSSEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRMKYSAVH                281 - 338
//

Text Mined References (33)

PMID Year Title