Property Summary

NCBI Gene PubMed Count 60
Grant Count 62
R01 Count 46
Funding $7,303,568.24
PubMed Score 100.75
PubTator Score 92.60

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q15311 D3DUI0 RalBP1
Symbols RIP1
RLIP1
RLIP76

Gene

PANTHER Protein Class (2)

PDB

2KWI   2KWH   2MBG  

Gene RIF (39)

PMID Text
26406496 RLIP76 expression is induced by TNF-alpha and follows the induction kinetics of inflammation markers, suggesting that inflammation can influence RLIP76 expression at the blood brain barrier.
26125275 report showed that RLIP76 expression was significantly increased in breast cancer samples and positively correlated with the malignant status of breast cancer patients; results indicated that high RLIP76 expression was associated with poor prognosis of breast cancer patients
26067553 results revealed that the effect of miR-101 on prostate cancer cell apoptosis was due to RLIP76 regulation of the PI3K/Akt/Bcl-2 signaling pathway
25993541 High RLIP76 expression is associated with a poor outcome of meningioma.
25213293 RLIP76 downregulation in HT29 CRC cells suppressed cell growth, enhanced cell apoptosis, induced cell cycle arrest, and inhibited cell invasion by decreasing MMP2 expression.
24839008 RLIP76 is a potential target for developing novel therapeutic strategies for leukemia
24450627 RLIP76 is a node for Rho and Ras family signalling. [Review]
23576547 Activation of RalBP1 during neoplastic epithelial cell transformation induces cytoplasmic accumulation of p27, this event requires p27 Ser-10 phosphorylation by protein kinase B/Akt.
23419874 p300 associates with the RLIP76 promoter via an overlapping cMYB and cETS binding site and regulates RLIP76 promoter activity and its expression.
23276796 RLIP76 may suppress apoptosis and promote the proliferation of glioma cells by direct adenosine triphosphate-dependent xenobiotic transport and by activating the Rac1-JNK signaling pathway.
More...

AA Sequence

MTECFLPPTSSPSEHRRVEHGSGLTRTPSSEEISPTKFPGLYRTGEPSPPHDILHEPPDVVSDDEKDHGK      1 - 70
KKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKMKRSKGIHVFKKPSFSKKKEKDFKIKEKPKEEKHKEEK     71 - 140
HKEEKHKEKKSKDLTAADVVKQWKEKKKKKKPIQEPEVPQIDVPNLKPIFGIPLADAVERTMMYDGIRLP    141 - 210
AVFRECIDYVEKYGMKCEGIYRVSGIKSKVDELKAAYDREESTNLEDYEPNTVASLLKQYLRDLPENLLT    211 - 280
KELMPRFEEACGRTTETEKVQEFQRLLKELPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTV    281 - 350
QISNRVLYVFFTHVQELFGNVVLKQVMKPLRWSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGI    351 - 420
KDLSKEERLWEVQRILTALKRKLREAKRQECETKIAQEIASLSKEDVSKEEMNENEEVINILLAQENEIL    421 - 490
TEQEELLAMEQFLRRQIASEKEEIERLRAEIAEIQSRQQHGRSETEEYSSESESESEDEEELQIILEDLQ    491 - 560
RQNEELEIKNNHLNQAIHEEREAIIELRVQLRLLQMQRAKAEQQAQEDEEPEWRGGAVQPPRDGVLEPKA    561 - 630
AKEQPKAGKEPAKPSPSRDRKETSI                                                 631 - 655
//

Text Mined References (71)

PMID Year Title
26406496 2015 Inflammation Modulates RLIP76/RALBP1 Electrophile-Glutathione Conjugate Transporter and Housekeeping Genes in Human Blood-Brain Barrier Endothelial Cells.
26125275 2015 RLIP76 expression as a prognostic marker of breast cancer.
26067553 2015 RLIP76-dependent suppression of PI3K/AKT/Bcl-2 pathway by miR-101 induces apoptosis in prostate cancer.
25993541 2015 Overexpression of RLIP76 Required for Proliferation in Meningioma Is Associated with Recurrence.
25416956 2014 A proteome-scale map of the human interactome network.
25213293 2015 RLIP76 blockade by siRNA inhibits proliferation, enhances apoptosis, and suppresses invasion in HT29 colon cancer cells.
24839008 2014 Knockdown of RLIP76 expression by RNA interference inhibits proliferation, enhances apoptosis, and increases chemosensitivity to daunorubicin in U937 leukemia cells.
24450627 2014 Structure and function of RLIP76 (RalBP1): an intersection point between Ras and Rho signalling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24056301 2013 The deubiquitylase USP33 discriminates between RALB functions in autophagy and innate immune response.
More...