Property Summary

NCBI Gene PubMed Count 136
Grant Count 131
R01 Count 87
Funding $13,825,711.3
PubMed Score 329.79
PubTator Score 229.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.485 0.001
osteosarcoma -2.209 0.000
periodontitis 2.000 0.000
lung cancer -1.900 0.000
interstitial cystitis 2.700 0.001
ulcerative colitis 1.800 0.000

Synonym

Accession Q15306 Q5VUI7 Q99660 IRF-4
Symbols MUM1
LSIRF
SHEP8
NF-EM5

Gene

PDB

2DLL  

Gene RIF (112)

PMID Text
26907189 IRF4 single nucleotide polymorphism is predictive factor of melanoma subtypes.
26857527 Role of IRF4 rs12203592 in pathway-specific risk for melanoma development. Hypothesize that IRF4 rs12203592 could underlie in part the bimodal age distribution reported for melanoma and linked to the divergent pathways
26728187 These results indicate that the KDM3A-KLF2-IRF4 pathway plays an essential role in multiple myeloma cell survival and homing to the bone marrow, and therefore represents a therapeutic target.
26276871 IRF4 is deregulated in B cells from common variable immunodeficiency patients, contributing to the observed aberrant expression of activation-induced deaminase in these patients.
26119939 The anti-PEL effects of IMiDs involved cereblon-dependent suppression of IRF4 and rapid degradation of IKZF1
25987254 inhibition of IRF4 translated into downregulation of c-Myc, caspase-10 and cFlip, relevant IRF4-downstream effectors
25740143 collagen I induces TNF- alpha production, which is crucial for the activation and function of DCs, through down-regulation of IRF4, and implicates the importance in development of anti- TNF-alpha therapeutics for several inflammatory diseases.
25724930 Overall, our data strongly suggest that IRF4, MC1R and TYR genes likely have pleiotropic effects, a combination of pigmentation and oncogenic functions, resulting in an increased risk of actinic keratosis.
25705849 IRF4 gene mutation is influencing facial pigmented spots.
25631878 Allele-specific transcriptional regulation of IRF4 in melanocytes is mediated by chromatin looping of the intronic rs12203592 enhancer to the IRF4 promoter
More...

AA Sequence

MNLEGGGRGGEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAAL      1 - 70
FKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPEGAKKGAKQLT     71 - 140
LEDPQMSMSHPYTMTTPYPSLPAQQVHNYMMPPLDRSWRDYVPDQPHPEIPYQCPMTFGPRGHHWQGPAC    141 - 210
ENGCQVTGTFYACAPPESQAPGVPTEPSIRSAEALAFSDCRLHICLYYREILVKELTTSSPEGCRISHGH    211 - 280
TYDASNLDQVLFPYPEDNGQRKNIEKLLSHLERGVVLWMAPDGLYAKRLCQSRIYWDGPLALCNDRPNKL    281 - 350
ERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQN    351 - 420
SGHFLRGYDLPEHISNPEDYHRSIRHSSIQE                                           421 - 451
//

Text Mined References (138)

PMID Year Title
26907189 2016 IRF4 SNP is predictive of melanoma subtypes.
26857527 2016 Association of Interferon Regulatory Factor-4 Polymorphism rs12203592 With Divergent Melanoma Pathways.
26728187 2016 The KDM3A-KLF2-IRF4 axis maintains myeloma cell survival.
26276871 2015 IRF4 Is a Critical Gene in Retinoic Acid-Mediated Plasma Cell Formation and Is Deregulated in Common Variable Immunodeficiency-Derived B Cells.
26119939 2016 Immunomodulatory drugs target IKZF1-IRF4-MYC axis in primary effusion lymphoma in a cereblon-dependent manner and display synergistic cytotoxicity with BRD4 inhibitors.
25987254 2015 Selective targeting of IRF4 by synthetic microRNA-125b-5p mimics induces anti-multiple myeloma activity in vitro and in vivo.
25740143 2015 Collagen I-induced dendritic cells activation is regulated by TNF-alpha production through down-regulation of IRF4.
25724930 2015 IRF4, MC1R and TYR genes are risk factors for actinic keratosis independent of skin color.
25705849 2015 A Genome-Wide Association Study Identifies the Skin Color Genes IRF4, MC1R, ASIP, and BNC2 Influencing Facial Pigmented Spots.
25631878 2015 Allele-specific transcriptional regulation of IRF4 in melanocytes is mediated by chromatin looping of the intronic rs12203592 enhancer to the IRF4 promoter.
More...