Property Summary

NCBI Gene PubMed Count 162
PubMed Score 365.31
PubTator Score 229.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.485 1.0e-03
interstitial cystitis 2.500 1.4e-02
lung cancer -1.900 1.7e-04
osteosarcoma -2.209 5.3e-07
periodontitis 2.000 6.6e-27
ulcerative colitis 1.800 2.5e-04

Gene RIF (138)

AA Sequence

MNLEGGGRGGEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQDYNREEDAAL      1 - 70
FKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPEGAKKGAKQLT     71 - 140
LEDPQMSMSHPYTMTTPYPSLPAQQVHNYMMPPLDRSWRDYVPDQPHPEIPYQCPMTFGPRGHHWQGPAC    141 - 210
ENGCQVTGTFYACAPPESQAPGVPTEPSIRSAEALAFSDCRLHICLYYREILVKELTTSSPEGCRISHGH    211 - 280
TYDASNLDQVLFPYPEDNGQRKNIEKLLSHLERGVVLWMAPDGLYAKRLCQSRIYWDGPLALCNDRPNKL    281 - 350
ERDQTCKLFDTQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQN    351 - 420
SGHFLRGYDLPEHISNPEDYHRSIRHSSIQE                                           421 - 451
//

Text Mined References (164)

PMID Year Title