Property Summary

Ligand Count 34
NCBI Gene PubMed Count 275
PubMed Score 558.22
PubTator Score 488.94

Knowledge Summary

Patent (110,652)

TINX Plot

  Disease (10)

Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 0.0136536264574044
Rheumatoid arthritis 1191 0.0 0.8
Disease Target Count Z-score Confidence
Polycystic ovary syndrome 360 0.0 5.0
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0
Disease Target Count Z-score Confidence
Cancer 2499 5.36 2.7
Disease Target Count
Amyotrophic lateral sclerosis 451

Expression

  Differential Expression (21)

Disease log2 FC p
lung cancer 2.000 1.9e-04
Breast cancer -1.700 1.4e-02
adult high grade glioma -1.700 7.0e-05
chronic rhinosinusitis -1.134 8.9e-03
cutaneous lupus erythematosus -1.500 3.5e-03
cystic fibrosis and chronic rhinosinusit... -1.194 2.1e-02
diabetes mellitus -1.200 3.5e-02
Endometriosis -1.223 1.5e-02
ependymoma -1.200 3.8e-02
facioscapulohumeral dystrophy 2.700 1.2e-06
fibroadenoma 1.500 2.5e-02
gastric carcinoma -1.100 1.9e-02
glioblastoma -2.100 4.2e-04
intraductal papillary-mucinous adenoma (... -1.300 1.5e-02
intraductal papillary-mucinous neoplasm ... -2.300 6.4e-03
lung adenocarcinoma -1.500 2.2e-14
lung carcinoma -1.600 2.7e-16
medulloblastoma, large-cell -2.700 4.7e-06
non-small cell lung cancer -1.462 5.8e-20
psoriasis -2.100 3.1e-04
subependymal giant cell astrocytoma -2.968 1.1e-02

Gene RIF (223)

AA Sequence

MKPATGLWVWVSLLVAAGTVQPSDSQSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVMGNLEITSIEH      1 - 70
NRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIFLNYRKDGNFGLQELGLKNLT     71 - 140
EILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNLTLVSTNGSSGCGRCHKSCTGRCWGPTENHCQTLTR    141 - 210
TVCAEQCDGRCYGPYVSDCCHRECAGGCSGPKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFN    211 - 280
AKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMSAQTVDS    281 - 350
SNIDKFINCTKINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNL    351 - 420
VTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDN    421 - 490
RKAENCTAEGMVCNHLCSSDGCWGPGPDQCLSCRRFSRGRICIESCNLYDGEFREFENGSICVECDPQCE    491 - 560
KMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGANSFIFKYADPDRECHPCHPNCTQGCNGPTS    561 - 630
HDCIYYPWTGHSTLPQHARTPLIAAGVIGGLFILVIVGLTFAVYVRRKSIKKKRALRRFLETELVEPLTP    631 - 700
SGTAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEAL    701 - 770
IMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLV    771 - 840
HRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTI    841 - 910
WELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARD    911 - 980
PQRYLVIQGDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAEEYLVPQAFNIPPPIYTSRARIDSNRSEIGH    981 - 1050
SPPPAYTPMSGNQFVYRDGGFAAEQGVSVPYRAPTSTIPEAPVAQGATAEIFDDSCCNGTLRKPVAPHVQ   1051 - 1120
EDSSTQRYSADPTVFAPERSPRGELDEEGYMTPMRDKPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHN   1121 - 1190
ASNGPPKAEDEYVNEPLYLNTFANTLGKAEYLKNNILSMPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQ   1191 - 1260
EYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTVLPPPPYRHRNTVV                         1261 - 1308
//

Text Mined References (297)

PMID Year Title