Property Summary

NCBI Gene PubMed Count 46
PubMed Score 22.88
PubTator Score 53.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Protein-protein Interaction (1)

Gene RIF (7)

AA Sequence

MDLSGVKKKSLLGVKENNKKSSTRAPSPTKRKDRSDEKSKDRSKDKGATKESSEKDRGRDKTRKRRSASS      1 - 70
GSSSTRSRSSSTSSSGSSTSTGSSSGSSSSSASSRSGSSSTSRSSSSSSSSGSPSPSRRRHDNRRRSRSK     71 - 140
SKPPKRDEKERKRRSPSPKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEF    141 - 210
ENPDEAEKALKHMDGGQIDGQEITATAVLAPWPRPPPRRFSPPRRMLPPPPMWRRSPPRMRRRSRSPRRR    211 - 280
SPVRRRSRSPGRRRHRSRSSSNSSR                                                 281 - 305
//

Text Mined References (55)

PMID Year Title