Property Summary

NCBI Gene PubMed Count 45
Grant Count 9
R01 Count 9
Funding $386,085.32
PubMed Score 22.28
PubTator Score 53.68

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
21508110 SRBD1 gene polymorphism is associated with the development of HTG as well as NTG, including late-onset NTG.
18854154 Knockdown of RNA binding protein S1, serine-rich domain (RNPS1) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
17959926 RNPS1 is able to function together with ASF/SF2 to form ribonucleoprotein complexes on nascent transcripts, and thereby prevent formation of transcriptional R-loops.
15684395 The phosphorylation of RNPS1 at Ser-53 influences the efficiencies of both splicing and translation.
11546874 has a role in mRNA surveillance (detecting mRNAs with truncated open reading frames and subjecting them to nonsense-mediated mRNA decay (NMD))
11546873 binds to Upf complexes which bind upstream of mRNA exon-exon junctions

AA Sequence

MDLSGVKKKSLLGVKENNKKSSTRAPSPTKRKDRSDEKSKDRSKDKGATKESSEKDRGRDKTRKRRSASS      1 - 70
GSSSTRSRSSSTSSSGSSTSTGSSSGSSSSSASSRSGSSSTSRSSSSSSSSGSPSPSRRRHDNRRRSRSK     71 - 140
SKPPKRDEKERKRRSPSPKPTKVHIGRLTRNVTKDHIMEIFSTYGKIKMIDMPVERMHPHLSKGYAYVEF    141 - 210
ENPDEAEKALKHMDGGQIDGQEITATAVLAPWPRPPPRRFSPPRRMLPPPPMWRRSPPRMRRRSRSPRRR    211 - 280
SPVRRRSRSPGRRRHRSRSSSNSSR                                                 281 - 305
//

Text Mined References (53)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25920683 2015 Inherited and Somatic Defects in DDX41 in Myeloid Neoplasms.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23084401 2012 The cellular EJC interactome reveals higher-order mRNP structure and an EJC-SR protein nexus.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22388736 2012 The structure of the ASAP core complex reveals the existence of a Pinin-containing PSAP complex.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22203037 2012 Proteins associated with the exon junction complex also control the alternative splicing of apoptotic regulators.
21508110 2011 Association between SRBD1 and ELOVL5 gene polymorphisms and primary open-angle glaucoma.
More...