Property Summary

NCBI Gene PubMed Count 35
PubMed Score 42.90
PubTator Score 26.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
acute myeloid leukemia 2.100 1.9e-02
Gaucher disease type 1 -1.200 2.2e-02
osteosarcoma 1.391 8.9e-05
psoriasis 1.600 1.0e-04

 GWAS Trait (1)

Gene RIF (23)

AA Sequence

MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERF      1 - 70
RTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAG     71 - 140
QMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC             141 - 201
//

Text Mined References (41)

PMID Year Title