Property Summary

NCBI Gene PubMed Count 29
Grant Count 18
R01 Count 3
Funding $2,326,036.04
PubMed Score 38.07
PubTator Score 26.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 1.600 0.000
osteosarcoma 1.391 0.000
acute myeloid leukemia 2.100 0.019
Gaucher disease type 1 -1.200 0.022

Gene RIF (17)

PMID Text
26725203 Authors propose that the precise spatial and temporal activation of Rab35 acts as a major switch for OCRL recruitment on newborn endosomes, post-scission PtdIns(4,5)P2 hydrolysis, and subsequent endosomal trafficking.
26338797 Two somatic RAB35 mutations found in human tumors generate alleles that constitutively activate PI3K/AKT signaling, suppress apoptosis, and transform cells in a PI3K-dependent manner.
26229970 the activation-inactivation cycles of Rab35 and ARF6 are required for the uptake of zymosan and that ACAP2 is an important component that links Rab35/ARF6 signaling during phagocytosis of zymosan.
25988331 Rab35 serves as a clathrin-mediated endocytosis detector. Loss of Rab35 input leads to elevated Arf6-GTP and shifts the sorting of clathrin-independent endocytosis cargo proteins to lysosomes.
23353182 Rab35 acts as a downstream target of Dvl2 and mediates cell migration.
23264734 mutual regulation with arf6 of cell adhesion and migration
22226746 Activated ARF6 reduces Rab35 loading into the endocytic pathway.
22072793 whereas connecdenn 1 and 2 activate Rab35 for endosomal trafficking, connecdenn 3 uniquely activates Rab35 for its role in actin regulation
22065758 analysis of DENND1B-S complexed with its substrate Rab35
21706022 the phosphatidylinositol-4,5-bisphosphate (PtdIns(4,5)P2) 5-phosphatase OCRL, which is mutated in Lowe syndrome patients, is an effector of the Rab35 GTPase in cytokinesis abscission
More...

AA Sequence

MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERF      1 - 70
RTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAG     71 - 140
QMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC             141 - 201
//

Text Mined References (35)

PMID Year Title
26725203 2016 Rab35 GTPase Triggers Switch-like Recruitment of the Lowe Syndrome Lipid Phosphatase OCRL on Newborn Endosomes.
26338797 2015 Identification of an oncogenic RAB protein.
26229970 2015 Activation-Inactivation Cycling of Rab35 and ARF6 Is Required for Phagocytosis of Zymosan in RAW264 Macrophages.
25988331 2015 Sorting of Clathrin-Independent Cargo Proteins Depends on Rab35 Delivered by Clathrin-Mediated Endocytosis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23353182 2013 Rab35 is required for Wnt5a/Dvl2-induced Rac1 activation and cell migration in MCF-7 breast cancer cells.
23264734 2013 Interplay between Rab35 and Arf6 controls cargo recycling to coordinate cell adhesion and migration.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22307087 2012 Reversible phosphocholination of Rab proteins by Legionella pneumophila effector proteins.
22226746 2012 An ARF6/Rab35 GTPase cascade for endocytic recycling and successful cytokinesis.
More...