Property Summary

NCBI Gene PubMed Count 9
PubMed Score 8.68
PubTator Score 14.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Synonym

Accession Q15283 A8K7K1 G3V0F9 O00695 Q15284 Q92594 Q99577 Q9UEQ2
Symbols GAP1M

Gene

Gene RIF (2)

PMID Text
26502337 Recurrent inactivating RASA2 mutations are associated with melanoma.
10074452 GAP1m is a Ras GAP that switches off Ras signalling. GAP1m undergoes a plasma membrane association following growth factor stimulation of PI 3-kinase as a result of its PH domain binding to phosphatidylinositol 3,4,5-trisphosphate.

AA Sequence

MAAAAPAAAAASSEAPAASATAEPEAGDQDSREVRVLQSLRGKICEAKNLLPYLGPHKMRDCFCTINLDQ      1 - 70
EEVYRTQVVEKSLSPFFSEEFYFEIPRTFQYLSFYVYDKNVLQRDLRIGKVAIKKEDLCNHSGKETWFSL     71 - 140
QPVDSNSEVQGKVHLELKLNELITENGTVCQQLVVHIKACHGLPLINGQSCDPYATVSLVGPSRNDQKKT    141 - 210
KVKKKTSNPQFNEIFYFEVTRSSSYTRKSQFQVEEEDIEKLEIRIDLWNNGNLVQDVFLGEIKVPVNVLR    211 - 280
TDSSHQAWYLLQPRDNGNKSSKTDDLGSLRLNICYTEDYVLPSEYYGPLKTLLLKSPDVQPISASAAYIL    281 - 350
SEICRDKNDAVLPLVRLLLHHDKLVPFATAVAELDLKDTQDANTIFRGNSLATRCLDEMMKIVGGHYLKV    351 - 420
TLKPILDEICDSSKSCEIDPIKLKEGDNVENNKENLRYYVDKLFNTIVKSSMSCPTVMCDIFYSLRQMAT    421 - 490
QRFPNDPHVQYSAVSSFVFLRFFAVAVVSPHTFHLRPHHPDAQTIRTLTLISKTIQTLGSWGSLSKSKSS    491 - 560
FKETFMCEFFKMFQEEGYIIAVKKFLDEISSTETKESSGTSEPVHLKEGEMYKRAQGRTRIGKKNFKKRW    561 - 630
FCLTSRELTYHKQPGSKDAIYTIPVKNILAVEKLEESSFNKKNMFQVIHTEKPLYVQANNCVEANEWIDV    631 - 700
LCRVSRCNQNRLSFYHPSVYLNGNWLCCQETGENTLGCKPCTAGVPADIQIDIDEDRETERIYSLFTLSL    701 - 770
LKLQKMEEACGTIAVYQGPQKEPDDYSNFVIEDSVTTFKTIQQIKSIIEKLDEPHEKYRKKRSSSAKYGS    771 - 840
KENPIVGKAS                                                                841 - 850
//

Text Mined References (13)

PMID Year Title
26502337 2015 Recurrent inactivating RASA2 mutations in melanoma.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22210626 2012 Genome-wide association study in multiple human prion diseases suggests genetic risk factors additional to PRNP.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
10074452 1999 Identification of the ras GTPase-activating protein GAP1(m) as a phosphatidylinositol-3,4,5-trisphosphate-binding protein in vivo.
9382842 1997 Distinct subcellular localisations of the putative inositol 1,3,4,5-tetrakisphosphate receptors GAP1IP4BP and GAP1m result from the GAP1IP4BP PH domain directing plasma membrane targeting.
More...