Property Summary

NCBI Gene PubMed Count 18
PubMed Score 100.63
PubTator Score 26.77

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q15274 Q53XW7 Q96G22 Q9BSG6
Symbols QPRTase
HEL-S-90n

Gene

PDB

2JBM   4KWV   4KWW   5AYX   5AYY   5AYZ  

Gene RIF (2)

PMID Text
24038671 Report of the crystal structure of human QPRT bound to its inhibitor phthalic acid (PHT) and kinetic analysis of PHT inhibition of human QPRT.
19321014 QPRT is a potential new marker for the immunohistochemical screening of follicular thyroid nodules.

AA Sequence

MDAEGLALLLPPVTLAALVDSWLREDCPGLNYAALVSGAGPSQAALWAKSPGVLAGQPFFDAIFTQLNCQ      1 - 70
VSWFLPEGSKLVPVARVAEVRGPAHCLLLGERVALNTLARCSGIASAAAAAVEAARGAGWTGHVAGTRKT     71 - 140
TPGFRLVEKYGLLVGGAASHRYDLGGLVMVKDNHVVAAGGVEKAVRAARQAADFTLKVEVECSSLQEAVQ    141 - 210
AAEAGADLVLLDNFKPEELHPTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALD    211 - 280
FSLKLFAKEVAPVPKIH                                                         281 - 297
//

Text Mined References (20)

PMID Year Title
26114426 2015 Expression of the Kynurenine Pathway in Human Peripheral Blood Mononuclear Cells: Implications for Inflammatory and Neurodegenerative Disease.
26025142 2015 Activation of the kynurenine pathway and increased production of the excitotoxin quinolinic acid following traumatic brain injury in humans.
25464930 2015 Novel interactive partners of neuroligin 3: new aspects for pathogenesis of autism.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24038671 2014 The crystal structure of human quinolinic acid phosphoribosyltransferase in complex with its inhibitor phthalic acid.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
19321014 2009 QPRT: a potential marker for follicular thyroid carcinoma including minimal invasive variant; a gene expression, RNA and immunohistochemical study.
More...