Property Summary

NCBI Gene PubMed Count 18
PubMed Score 100.63
PubTator Score 26.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 3.81686417475494E-11
pilocytic astrocytoma 3086 6.99499836760622E-6
Breast cancer 3099 1.57434186137759E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.18856313743299E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 3.38003709289698E-4
pancreatic cancer 2300 0.00167849974073518
interstitial cystitis 2299 0.00186224997714533
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00229001655483862
pediatric high grade glioma 2712 0.00234051421893197
subependymal giant cell astrocytoma 2287 0.00268362673493191
ductal carcinoma in situ 1745 0.00281863025672374
ovarian cancer 8492 0.00285428904294277
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00435124528512273
invasive ductal carcinoma 2950 0.0195954884414288
glioblastoma 5572 0.0215841441041457
urothelial carcinoma 318 0.0261811875883367
non primary Sjogren syndrome sicca 840 0.0298301614730382
Disease Target Count Z-score Confidence
Pellagra 25 4.315 2.2
Rectal prolapse 12 3.133 1.6
Huntington's disease 72 3.048 1.5

Expression

Synonym

Accession Q15274 Q53XW7 Q96G22 Q9BSG6
Symbols QPRTase
HEL-S-90n

Gene

PDB

2JBM   4KWV   4KWW   5AYX   5AYY   5AYZ  

  Ortholog (8)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
24038671 Report of the crystal structure of human QPRT bound to its inhibitor phthalic acid (PHT) and kinetic analysis of PHT inhibition of human QPRT.
19321014 QPRT is a potential new marker for the immunohistochemical screening of follicular thyroid nodules.

AA Sequence

MDAEGLALLLPPVTLAALVDSWLREDCPGLNYAALVSGAGPSQAALWAKSPGVLAGQPFFDAIFTQLNCQ      1 - 70
VSWFLPEGSKLVPVARVAEVRGPAHCLLLGERVALNTLARCSGIASAAAAAVEAARGAGWTGHVAGTRKT     71 - 140
TPGFRLVEKYGLLVGGAASHRYDLGGLVMVKDNHVVAAGGVEKAVRAARQAADFTLKVEVECSSLQEAVQ    141 - 210
AAEAGADLVLLDNFKPEELHPTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALD    211 - 280
FSLKLFAKEVAPVPKIH                                                         281 - 297
//

Text Mined References (20)

PMID Year Title
26114426 2015 Expression of the Kynurenine Pathway in Human Peripheral Blood Mononuclear Cells: Implications for Inflammatory and Neurodegenerative Disease.
26025142 2015 Activation of the kynurenine pathway and increased production of the excitotoxin quinolinic acid following traumatic brain injury in humans.
25464930 2015 Novel interactive partners of neuroligin 3: new aspects for pathogenesis of autism.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24038671 2014 The crystal structure of human quinolinic acid phosphoribosyltransferase in complex with its inhibitor phthalic acid.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
19321014 2009 QPRT: a potential marker for follicular thyroid carcinoma including minimal invasive variant; a gene expression, RNA and immunohistochemical study.
More...