Property Summary

NCBI Gene PubMed Count 20
PubMed Score 104.36
PubTator Score 26.77

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

AA Sequence

MDAEGLALLLPPVTLAALVDSWLREDCPGLNYAALVSGAGPSQAALWAKSPGVLAGQPFFDAIFTQLNCQ      1 - 70
VSWFLPEGSKLVPVARVAEVRGPAHCLLLGERVALNTLARCSGIASAAAAAVEAARGAGWTGHVAGTRKT     71 - 140
TPGFRLVEKYGLLVGGAASHRYDLGGLVMVKDNHVVAAGGVEKAVRAARQAADFTLKVEVECSSLQEAVQ    141 - 210
AAEAGADLVLLDNFKPEELHPTATVLKAQFPSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALD    211 - 280
FSLKLFAKEVAPVPKIH                                                         281 - 297
//

Text Mined References (22)

PMID Year Title