Property Summary

NCBI Gene PubMed Count 101
Grant Count 1,129
R01 Count 760
Funding $103,372,629.61
PubMed Score 1739.92
PubTator Score 991.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma -1.300 0.000
posterior fossa group B ependymoma -1.100 0.000

Synonym

Accession Q15257 A2A347 A9IZU4 B4DXM4 Q15258 Q53GZ3 Q5TZQ2 Q9BUK1 Q9NNZ7 Q9NNZ8 Q9NNZ9
Symbols PP2A
PR53
PPP2R4

Gene

PDB

2G62   2HV6   2HV7   2IXM   4LAC   4NY3  

 MGI Term (1)

Gene RIF (88)

PMID Text
26365192 Cohesin complex is shown to be a target of the prophase pathway at centrosomes and protected by Sgo1-dependent PP2A recruitment.
26148238 we propose that RhoB could be responsible for early metastatic prevention by inhibiting the EMT-derived invasiveness of lung cells through the control of PP2A activity.
26068931 Zinc-alpha2-glycoprotein modulates AKT-dependent insulin signaling in adipocytes by activation of the PP2A phosphatase.
25985190 these data reveal the molecular mechanisms of PP2A regulation and highlight the potential of boosting the power of endogenous phosphatases as novel anti-inflammatory strategies to combat asthmatic inflammation.
25662052 Transgenic overexpression of myocardial PP2A causes adverse remodeling which coincides with a disruption of the classical Akt/GSK3/beta-catenin pathway under baseline conditions that is restored to normal values in chronic myocardial infarction.
25625869 an increase in the phosphorylation level of PTPalphaTyr789 by its upstream activator, FAKDel33, leading to Src activation in certain breast cancer cells, which has significant implications for metastatic potential.
25492966 results suggested that PPFIA1 functioned with PP2A to promote the dephosphorylation of Kif7, triggering Kif7 localization to the tips of primary cilia and promoting Gli transcriptional activity.
25096578 We have also defined in the actin-binding protein cofilin-1 a link between PP2A, actin cytoskeleton, and necrotic death
25056877 REDD1 may act as a targeting protein for the catalytic subunit of PP2A
25003389 The invariant C-terminal residues of the catalytic subunit can act as affinity enhancer for different PP2A interaction partners, including PTPA, and a different 'code' of posttranslational modifications can favour interactions to one subunit over others.
More...

AA Sequence

MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRV      1 - 70
SEMWNEVHEEKEQAAKQSVSCDECIPLPRAGHCAPSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAY     71 - 140
RTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVD    141 - 210
DQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVN    211 - 280
ENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLL    281 - 350
PIHPVTSG                                                                  351 - 358
//

Text Mined References (104)

PMID Year Title
26365192 2015 An Alternatively Spliced Bifunctional Localization Signal Reprograms Human Shugoshin 1 to Protect Centrosomal Instead of Centromeric Cohesin.
26148238 2016 RhoB loss induces Rac1-dependent mesenchymal cell invasion in lung cells through PP2A inhibition.
26068931 2015 Zinc-?2-Glycoprotein Modulates AKT-Dependent Insulin Signaling in Human Adipocytes by Activation of the PP2A Phosphatase.
25985190 2015 Basal protein phosphatase 2A activity restrains cytokine expression: role for MAPKs and tristetraprolin.
25662052 2015 Overexpression of protein phosphatase 2A in a murine model of chronic myocardial infarction leads to increased adverse remodeling but restores the regulation of ?-catenin by glycogen synthase kinase 3?.
25625869 2015 Focal adhesion kinase regulates the phosphorylation protein tyrosine phosphatase-? at Tyr789 in breast cancer cells.
25492966 2014 The PPFIA1-PP2A protein complex promotes trafficking of Kif7 to the ciliary tip and Hedgehog signaling.
25416956 2014 A proteome-scale map of the human interactome network.
25096578 2014 A receptor-interacting protein 1 (RIP1)-independent necrotic death under the control of protein phosphatase PP2A that involves the reorganization of actin cytoskeleton and the action of cofilin-1.
25056877 2014 REDD1 enhances protein phosphatase 2A-mediated dephosphorylation of Akt to repress mTORC1 signaling.
More...