Property Summary

Ligand Count 1
NCBI Gene PubMed Count 119
PubMed Score 1802.47
PubTator Score 991.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma -1.200 3.8e-04
posterior fossa group B ependymoma -1.100 4.2e-09

 MGI Phenotype (1)

Protein-protein Interaction (1)

Gene RIF (102)

AA Sequence

MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRV      1 - 70
SEMWNEVHEEKEQAAKQSVSCDECIPLPRAGHCAPSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAY     71 - 140
RTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVD    141 - 210
DQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVN    211 - 280
ENHKDYMFLECILFITEMKTGPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLL    281 - 350
PIHPVTSG                                                                  351 - 358
//

Text Mined References (122)

PMID Year Title