Property Summary

NCBI Gene PubMed Count 36
PubMed Score 48.44
PubTator Score 19.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -3.900 1.3e-06
astrocytic glioma -3.400 1.1e-03
Astrocytoma, Pilocytic -4.700 5.3e-13
atypical teratoid / rhabdoid tumor -4.500 4.9e-11
cystic fibrosis 1.004 7.8e-04
ependymoma -3.800 8.3e-04
glioblastoma -3.900 6.0e-13
interstitial cystitis -2.400 1.3e-02
intraductal papillary-mucinous adenoma (... 1.200 2.5e-03
intraductal papillary-mucinous carcinoma... 2.200 6.6e-05
intraductal papillary-mucinous neoplasm ... 3.700 1.0e-05
malignant mesothelioma 3.000 8.1e-07
medulloblastoma -1.900 7.0e-03
medulloblastoma, large-cell -3.200 1.8e-03
oligodendroglioma -3.300 1.9e-03
pancreatic cancer 1.800 1.1e-04
Pick disease -1.100 1.0e-02
primitive neuroectodermal tumor -3.800 5.4e-05
subependymal giant cell astrocytoma -2.118 5.0e-02
ulcerative colitis -1.475 3.0e-02

Gene RIF (11)

AA Sequence

MRRAVCFPALCLLLNLHAAGCFSGNNDHFLAINQKKSGKPVFIYKHSQDIEKSLDIAPQKIYRHSYHSSS      1 - 70
EAQVSKRHQIVNSAFPRPAYDPSLNLLAMDGQDLEVENLPIPAANVIVVTLQMDVNKLNITLLRIFRQGV     71 - 140
AAALGLLPQQVHINRLIGKKNSIELFVSPINRKTGISDALPSEEVLRSLNINVLHQSLSQFGITEVSPEK    141 - 210
NVLQGQHEADKIWSKEGFYAVVIFLSIFVIIVTCLMILYRLKERFQLSLRQDKEKNQEIHLSPITLQPAL    211 - 280
SEAKTVHSMVQPEQAPKVLNVVVDPQGRGAPEIKATTATSVCPSPFKMKPIGLQERRGSNVSLTLDMSSL    281 - 350
GNIEPFVSIPTPREKVAMEYLQSASRILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNR    351 - 420
YKTILPNPLSRVCLRPKNVTDSLSTYINANYIRGYSGKEKAFIATQGPMINTVDDFWQMVWQEDSPVIVM    421 - 490
ITKLKEKNEKCVLYWPEKRGIYGKVEVLVISVNECDNYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDS    491 - 560
AQPLLQLMLDVEEDRLASQGRGPVVVHCSAGIGRTGCFIATSIGCQQLKEEGVVDALSIVCQLRMDRGGM    561 - 630
VQTSEQYEFVHHALCLYESRLSAETVQ                                               631 - 657
//

Text Mined References (36)

PMID Year Title