Property Summary

NCBI Gene PubMed Count 35
Grant Count 4
R01 Count 4
Funding $364,595.13
PubMed Score 44.69
PubTator Score 19.14

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q15256 B2R5Z7 B7Z3J1 F5GXR7 O00342 Q92682 Q9UE65 R-PTP-R
Symbols PTPRQ
EC-PTP
PCPTP1
PTP-SL
PTPBR7

Gene

PDB

2A8B  

Gene RIF (10)

PMID Text
25592066 Results show that PTPRR is an early and direct target of the androgen receptor which negatively regulates the RAS/ERK1/2 pathway suggesting that its loss in prostate cancer cells is one factor that might contribute to activation of the RAS/ERK1/2 pathway.
24407576 The methylation index of PTPRR recovered from scrapings of uterine cervix adenocarcinomas is significantly higher than in normal controls.
24242166 High expression of PTP receptors R and Z1 was observed in all examined cases of colorectal carcinoma, adenoma and normal colon tissue in this study.
23422819 3 genes identified by association study and supported by ocular expression and/or replication, UHRF1BP1L, PTPRR, and PPFIA2, are novel candidates for myopic development within the MYP3 locus that should be further studied.
22330137 Methylation of the PTPRR promoter has an important role in the metastasis and may be a biomarker of invasive cervical cancer
22100128 the protein tyrosine phosphatase receptor type R gene may play a role in conferring risk of major depressive disorder in females
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20015382 expression of the PTPRR-1 isoform was inactivated in colorectal cancer cells as a result of de novo CpG island methylation and enrichment of transcription-repressive histone-tail marks, mainly H3K27me3
16441242 determined high-resolution structures of all of the human family members of Mitogen-Activated Protein Kinase-specific protein tyrosine phosphatases

AA Sequence

MRRAVCFPALCLLLNLHAAGCFSGNNDHFLAINQKKSGKPVFIYKHSQDIEKSLDIAPQKIYRHSYHSSS      1 - 70
EAQVSKRHQIVNSAFPRPAYDPSLNLLAMDGQDLEVENLPIPAANVIVVTLQMDVNKLNITLLRIFRQGV     71 - 140
AAALGLLPQQVHINRLIGKKNSIELFVSPINRKTGISDALPSEEVLRSLNINVLHQSLSQFGITEVSPEK    141 - 210
NVLQGQHEADKIWSKEGFYAVVIFLSIFVIIVTCLMILYRLKERFQLSLRQDKEKNQEIHLSPITLQPAL    211 - 280
SEAKTVHSMVQPEQAPKVLNVVVDPQGRGAPEIKATTATSVCPSPFKMKPIGLQERRGSNVSLTLDMSSL    281 - 350
GNIEPFVSIPTPREKVAMEYLQSASRILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNR    351 - 420
YKTILPNPLSRVCLRPKNVTDSLSTYINANYIRGYSGKEKAFIATQGPMINTVDDFWQMVWQEDSPVIVM    421 - 490
ITKLKEKNEKCVLYWPEKRGIYGKVEVLVISVNECDNYTIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDS    491 - 560
AQPLLQLMLDVEEDRLASQGRGPVVVHCSAGIGRTGCFIATSIGCQQLKEEGVVDALSIVCQLRMDRGGM    561 - 630
VQTSEQYEFVHHALCLYESRLSAETVQ                                               631 - 657
//

Text Mined References (35)

PMID Year Title
25592066 2015 Androgen-regulation of the protein tyrosine phosphatase PTPRR activates ERK1/2 signalling in prostate cancer cells.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
24407576 2014 High methylation rate of LMX1A, NKX6-1, PAX1, PTPRR, SOX1, and ZNF582 genes in cervical adenocarcinoma.
24242166 2014 Immunohistochemical and Western blot analysis of two protein tyrosine phosphatase receptors, R and Z1, in colorectal carcinoma, colon adenoma and normal colon tissues.
23422819 2013 Association mapping of the high-grade myopia MYP3 locus reveals novel candidates UHRF1BP1L, PTPRR, and PPFIA2.
23396134 2013 Genome-wide meta-analyses of multiancestry cohorts identify multiple new susceptibility loci for refractive error and myopia.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22330137 2013 Epigenetic silencing of PTPRR activates MAPK signaling, promotes metastasis and serves as a biomarker of invasive cervical cancer.
22100128 2012 Gender-specific role of the protein tyrosine phosphatase receptor type R gene in major depressive disorder.
More...