Property Summary

NCBI Gene PubMed Count 19
Grant Count 3
Funding $1,397,680
PubMed Score 11.16
PubTator Score 7.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 3.300 0.000
cystic fibrosis 2.340 0.000
Breast cancer -1.300 0.021
ovarian cancer -1.100 0.000

Gene RIF (4)

PMID Text
23469002 show that human PSG1 binds alphaIIbbeta3 and inhibits the platelet - fibrinogen interaction. Unexpectedly, however, the KGD is not critical as multiple PSG1 domains independently bind and inhibit alphaIIbbeta3 function
23418492 esults are consistent with a regulatory role of lysine acetylation on PSG expression through a relaxed chromatin state and an increase in the transcriptional activity of Sp1 and KLF6 following an augmented Sp1 acetylation and KLF6 nuclear localization.
17978129 the mRNA expression of PREGNANCY-SPECIFIC BETA-1-GLYCOPROTEIN is up-regulated in cells circulating within blood from women with preeclampsia, and is positively correlated with cliical severity
16563348 Strong synergic activity of KLF4 and Sp1 on the PSG-5 promoter.

AA Sequence

MGPLSAPPCTQHITWKGLLLTASLLNFWNLPITAQVTIEALPPKVSEGKDVLLLVHNLPQNLAGYIWYKG      1 - 70
QLMDLYHYITSYVVDGQINIYGPAYTGRETVYSNASLLIQNVTREDAGSYTLHIIKRGDRTRGVTGYFTF     71 - 140
NLYLKLPKPYITINNSKPRENKDVLAFTCEPKSENYTYIWWLNGQSLPVSPRVKRPIENRILILPSVTRN    141 - 210
ETGPYECEIRDRDGGMRSDPVTLNVLYGPDLPSIYPSFTYYRSGENLYLSCFAESNPPAEYFWTINGKFQ    211 - 280
QSGQKLSIPQITTKHRGLYTCSVRNSATGKESSKSMTVEVSAPSGIGRLPLLNPI                   281 - 335
//

Text Mined References (21)

PMID Year Title
23469002 2013 Pregnancy-specific glycoproteins bind integrin ?IIb?3 and inhibit the platelet-fibrinogen interaction.
23418492 2013 PSG gene expression is up-regulated by lysine acetylation involving histone and nonhistone proteins.
21982860 2012 A secreted protein microarray platform for extracellular protein interaction discovery.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
17978129 2007 Placenta-derived, cellular messenger RNA expression in the maternal blood of preeclamptic women.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16563348 2006 Activation of the human pregnancy-specific glycoprotein PSG-5 promoter by KLF4 and Sp1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
More...