Property Summary

NCBI Gene PubMed Count 19
PubMed Score 12.16
PubTator Score 7.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Arthritis, Rheumatoid 174 0.0 0.0
Disease Target Count
Rheumatoid arthritis 1191
Disease Target Count P-value
malignant mesothelioma 3232 5.5e-09
cystic fibrosis 1696 1.2e-06
ovarian cancer 8520 1.8e-05
Breast cancer 3578 2.1e-02

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer -1.300 2.1e-02
cystic fibrosis 2.340 1.2e-06
malignant mesothelioma 3.300 5.5e-09
ovarian cancer -1.100 1.8e-05

 GO Component (1)

 GO Process (1)

Gene RIF (4)

AA Sequence

MGPLSAPPCTQHITWKGLLLTASLLNFWNLPITAQVTIEALPPKVSEGKDVLLLVHNLPQNLAGYIWYKG      1 - 70
QLMDLYHYITSYVVDGQINIYGPAYTGRETVYSNASLLIQNVTREDAGSYTLHIIKRGDRTRGVTGYFTF     71 - 140
NLYLKLPKPYITINNSKPRENKDVLAFTCEPKSENYTYIWWLNGQSLPVSPRVKRPIENRILILPSVTRN    141 - 210
ETGPYECEIRDRDGGMRSDPVTLNVLYGPDLPSIYPSFTYYRSGENLYLSCFAESNPPAEYFWTINGKFQ    211 - 280
QSGQKLSIPQITTKHRGLYTCSVRNSATGKESSKSMTVEVSAPSGIGRLPLLNPI                   281 - 335
//

Text Mined References (21)

PMID Year Title