Property Summary

NCBI Gene PubMed Count 87
PubMed Score 526.91
PubTator Score 95.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
acute myeloid leukemia 1.200 3.6e-02
diabetes mellitus -1.900 1.1e-03
lung adenocarcinoma 1.200 7.2e-06

Protein-protein Interaction (9)

Gene RIF (58)

AA Sequence

MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQPPPPPIPANGQQASSQNEGLTIDLKNFRKPGEKTF      1 - 70
TQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRLETRTLAEIAKVELDNMPLRGKQLR     71 - 140
VRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDRGRPSGKGIVEFSGKPAARKALDRCSE    141 - 210
GSFLLTTFPRPVTVEPMDQLDDEEGLPEKLVIKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIEMEKQ    211 - 280
QQDQVDRNIKEAREKLEMEMEAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRR    281 - 350
REEEMRRQQEEMMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMM    351 - 420
PDGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY                       421 - 471
//

Text Mined References (106)

PMID Year Title