Property Summary

NCBI Gene PubMed Count 77
Grant Count 46
R01 Count 29
Funding $5,947,628.42
PubMed Score 487.46
PubTator Score 95.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus 2.000 0.001
lung adenocarcinoma 1.200 0.000
acute myeloid leukemia 1.200 0.036

Gene RIF (53)

PMID Text
26571461 Mutations in NONO led to defects at inhibitory synapses in intellectual disability syndrome.
26332123 p54nrb and hnRNPM knockdown silences the FGF1 promoter-dependent accumulation of mRNA during myoblast differentiation.
26148231 p54(nrb) is a novel regulator of SREBP-1a in the nucleus, and the data suggest that p54(nrb) regulation of SREBP-1a supports the increased cellular demand of lipids for breast cancer growth.
26060192 Subnuclear re-localization of SOX10 and p54NRB correlates with a unique neurological phenotype associated with SOX10 missense mutations
25998385 suggest that SFPQ.NONO promotes end joining by binding to internal DNA sequences and cooperating with other repair proteins to stabilize a synaptic pre-ligation complex
25893301 Data uncover a new role for NONO in mediating the cellular response to UV-induced DNA damage.
25769457 These data suggest that NonO negatively regulates HIV-1 infection in CD4(+) T cells, highlighting the importance of host proteins associated with HIV-1 preintegration complexes in regulating viral replication.
25769457 Knockdown of NONO expression by shRNA enhances both HIV-1 Gag expression in Jurkat cells and the released p24 levels from these cells
25769457 Knockdown of NONO expression by shRNA enhances both HIV-1 Gag expression in Jurkat cells and the released p24 levels from these cells
25769457 Knockdown of NONO by shRNA enhances HIV-1 replication in both Jurkat cells and primary CD4+ T-cells
More...

AA Sequence

MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQPPPPPIPANGQQASSQNEGLTIDLKNFRKPGEKTF      1 - 70
TQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRLETRTLAEIAKVELDNMPLRGKQLR     71 - 140
VRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDRGRPSGKGIVEFSGKPAARKALDRCSE    141 - 210
GSFLLTTFPRPVTVEPMDQLDDEEGLPEKLVIKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIEMEKQ    211 - 280
QQDQVDRNIKEAREKLEMEMEAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRR    281 - 350
REEEMRRQQEEMMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMM    351 - 420
PDGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY                       421 - 471
//

Text Mined References (95)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26571461 2015 Mutations in NONO lead to syndromic intellectual disability and inhibitory synaptic defects.
26332123 2015 Promoter-Dependent Translation Controlled by p54nrb and hnRNPM during Myoblast Differentiation.
26148231 2016 p54(nrb)/NONO regulates lipid metabolism and breast cancer growth through SREBP-1A.
26060192 2015 Subnuclear re-localization of SOX10 and p54NRB correlates with a unique neurological phenotype associated with SOX10 missense mutations.
25998385 2015 Characterization of DNA binding and pairing activities associated with the native SFPQ·NONO DNA repair protein complex.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25893301 2016 NONO regulates the intra-S-phase checkpoint in response to UV radiation.
25769457 2015 Non-POU Domain-Containing Octamer-Binding Protein Negatively Regulates HIV-1 Infection in CD4(+) T Cells.
25765647 2015 The structure of human SFPQ reveals a coiled-coil mediated polymer essential for functional aggregation in gene regulation.
More...