Property Summary

NCBI Gene PubMed Count 75
Grant Count 183
R01 Count 90
Funding $21,250,969
PubMed Score 361.38
PubTator Score 178.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.370 0.000
posterior fossa group A ependymoma -1.200 0.000
non-small cell lung cancer 1.187 0.000
lung cancer 2.700 0.001

Synonym

Accession Q15223 O75465 Q2M3D3 Q9HBE6 Q9HBW2
Symbols ED4
PRR
HIgR
HV1S
HVEC
OFC7
PRR1
PVRR
CD111
PVRL1
PVRR1
SK-12
CLPED1
nectin-1

Gene

PANTHER Protein Class (1)

PDB

3ALP   3SKU   3U82   3U83   4FMF   4MYW  

Gene RIF (51)

PMID Text
27044745 PDZD11 forms a complex with nectin-1 and nectin-3, and its PDZ domain interacts directly with the PDZ-binding motif of nectin-1.
25966106 mutations in exons 2 and 5 of PVRL1, and T334A, A391T, G1183A in the alpha-spliced transcript, and G1082T in the beta-spliced transcript do not participate in the development of non-syndromic cleft of the lip and/or palate in patients from Guangdong.
25414835 Host nectin-1 is required for efficient Chlamydia trachomatis serovar E development.
25395582 data suggests that E-cadherin regulates assembly of nectin junctions through alpha-catenin-induced remodeling of the actin cytoskeleton around the cadherin clusters.
25275122 Authors show that the same key residues in the BC and FG loops of nectin-4 govern binding to the measles virus attachment protein hemagglutinin (H) and cell entry, nectin-4 homodimerization, and heterodimerization with nectin-1.
25231300 These data provided solid structural and functional evidence that herpes simplex virus 1 and herpes simplex virus 2 gD proteins recognize nectin-1 via the same binding mode.
24902525 The results showed that the interface between the BV gD and nectin-1 molecule is not geometrically complementary.
24586397 HIV-1 gp120-mediated disruption of polarized oral epithelial junctions leads to exposure of nectin-1 and facilitate its binding to HSV-1
24586397 HIV-1 gp120-mediated disruption of polarized oral epithelial junctions leads to exposure of nectin-1 and facilitate its binding to HSV-1
24581844 We identified new supportive evidence that the association between PVRL1 gene and nsCL/P in Turkish patients.
More...

AA Sequence

MARMGLAGAAGRWWGLALGLTAFFLPGVHSQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKS      1 - 70
TNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNL     71 - 140
TVMAKPTNWIEGTQAVLRAKKGQDDKVLVATCTSANGKPPSVVSWETRLKGEAEYQEIRNPNGTVTVISR    141 - 210
YRLVPSREAHQQSLACIVNYHMDRFKESLTLNVQYEPEVTIEGFDGNWYLQRMDVKLTCKADANPPATEY    211 - 280
HWTTLNGSLPKGVEAQNRTLFFKGPINYSLAGTYICEATNPIGTRSGQVEVNITEFPYTPSPPEHGRRAG    281 - 350
PVPTAIIGGVAGSILLVLIVVGGIVVALRRRRHTFKGDYSTKKHVYGNGYSKAGIPQHHPPMAQNLQYPD    351 - 420
DSDDEKKAGPLGGSSYEEEEEEEEGGGGGERKVGGPHPKYDEDAKRPYFTVDEAEARQDGYGDRTLGYQY    421 - 490
DPEQLDLAENMVSQNDGSFISKKEWYV                                               491 - 517
//

Text Mined References (83)

PMID Year Title
27044745 2016 PLEKHA7 Recruits PDZD11 to Adherens Junctions to Stabilize Nectins.
26787460 2016 Proteomic peptide phage display uncovers novel interactions of the PDZ1-2 supramodule of syntenin.
25966106 2015 Mutation analysis of PVRL1 in patients with non-syndromic cleft of the lip and/or palate in Guangdong.
25414835 2014 Host nectin-1 is required for efficient Chlamydia trachomatis serovar E development.
25395582 2015 Cadherin controls nectin recruitment into adherens junctions by remodeling the actin cytoskeleton.
25275122 2014 Different roles of the three loops forming the adhesive interface of nectin-4 in measles virus binding and cell entry, nectin-4 homodimerization, and heterodimerization with nectin-1.
25231300 2014 Crystal structure of herpes simplex virus 2 gD bound to nectin-1 reveals a conserved mode of receptor recognition.
25158072 2015 Cross-disorder genome-wide analyses suggest a complex genetic relationship between Tourette's syndrome and OCD.
24902525 2014 Herpes B virus gD interaction with its human receptor--an in silico analysis approach.
24581844 2014 Novel insertion mutation in the PVRL1 gene in Turkish patients with non-syndromic cleft lip with/without cleft palate.
More...