Property Summary

NCBI Gene PubMed Count 46
PubMed Score 20.77
PubTator Score 90.73

Knowledge Summary

Patent (16,458)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
glioblastoma multiforme 347 3.36246616218668E-25
atypical teratoid / rhabdoid tumor 4369 5.13557442557287E-7
ovarian cancer 8492 1.1959887279289E-5
osteosarcoma 7933 2.43326242889785E-4
group 3 medulloblastoma 2254 3.8188187107188E-4
pancreatic cancer 2300 0.00407456554558147
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00670383775140847
primary pancreatic ductal adenocarcinoma 1271 0.011127086195454
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0117762217114589
active ulcerative colitis 477 0.0129768605772623
Breast cancer 3099 0.0215510499526643
spina bifida 1064 0.0457251670207913

Expression

Synonym

Accession Q15208 Q503A1
Symbols NDR
NDR1

Gene

PDB

1PSB  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA Inparanoid

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (21)

PMID Text
26387716 Data establish STK38 as a conserved regulator of autophagy in human cells and flies.
26057687 PLK1-mediated phosphorylation protects the binding of Mob1 to NDR1 and subsequent NDR1 activation
25936524 STK38-mediated phosphorylation of CDC25A at Ser-76 and the subsequent degradation of CDC25A are required to promote DNA damage-induced G2/M checkpoint activation.
23897809 cyclin D1 has a role in promoting cell cycle progression by enhancing NDR1/2 kinase activity independent of Cdk4
23886587 17-allylamino-17-demethoxygeldanamycin down-regulates STK38, modulating radiosensitivity.
23178486 STK38 regulates MYC protein stability and turnover in a kinase activity-dependent manner. STK38 kinase inactivation abrogates apoptosis following B-cell receptor activation, whereas its silencing significantly decreases MYC levels and increases apoptosis.
22674419 Findings suggest a function of NDR1, which may regulate NF-kappaB activation by its kinase activity.
22142472 GSK-3beta inhibits full activation of STK38, and STK38 activation is required to prevent cell death in response to oxidative stress
21730291 Findings show a biological role for MICAL-1 in apoptosis and define a novel negative regulatory mechanism of MST-NDR signaling.
21262772 These findings establish a novel MST3-NDR-p21 axis as an important regulator of G(1)/S progression of mammalian cells.
More...

AA Sequence

MAMTGSTPCSSMSNHTKERVTMTKVTLENFYSNLIAQHEEREMRQKKLEKVMEEEGLKDEEKRLRRSAHA      1 - 70
RKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVGHIRAERDI     71 - 140
LVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIH    141 - 210
RDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAF    211 - 280
STVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPIS    281 - 350
EKAKDLILRFCCEWEHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILK    351 - 420
PTVATSNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK                             421 - 465
//

Text Mined References (54)

PMID Year Title
26387716 2015 The Pro-apoptotic STK38 Kinase Is a New Beclin1 Partner Positively Regulating Autophagy.
26057687 2015 Regulation of NDR1 activity by PLK1 ensures proper spindle orientation in mitosis.
25936524 2015 Serine-Threonine Kinase 38 regulates CDC25A stability and the DNA damage-induced G2/M checkpoint.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25601544 2015 NDR functions as a physiological YAP1 kinase in the intestinal epithelium.
25576923 2015 Sema6A and Mical1 control cell growth and survival of BRAFV600E human melanoma cells.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24928906 2014 Rassf5 and Ndr kinases regulate neuronal polarity through Par3 phosphorylation in a novel pathway.
24786771 2014 Phosphorylation-dephosphorylation cycle of HP1? governs accurate mitotic progression.
24747552 2014 Constitutively active NDR1-PIF kinase functions independent of MST1 and hMOB1 signalling.
More...