Property Summary

NCBI Gene PubMed Count 46
Grant Count 53
R01 Count 43
Funding $5,729,751.22
PubMed Score 20.77
PubTator Score 90.73

Knowledge Summary

Patent (16,458)

Expression

Synonym

Accession Q15208 Q503A1
Symbols NDR
NDR1

Gene

PDB

1PSB  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (21)

PMID Text
26387716 Data establish STK38 as a conserved regulator of autophagy in human cells and flies.
26057687 PLK1-mediated phosphorylation protects the binding of Mob1 to NDR1 and subsequent NDR1 activation
25936524 STK38-mediated phosphorylation of CDC25A at Ser-76 and the subsequent degradation of CDC25A are required to promote DNA damage-induced G2/M checkpoint activation.
23897809 cyclin D1 has a role in promoting cell cycle progression by enhancing NDR1/2 kinase activity independent of Cdk4
23886587 17-allylamino-17-demethoxygeldanamycin down-regulates STK38, modulating radiosensitivity.
23178486 STK38 regulates MYC protein stability and turnover in a kinase activity-dependent manner. STK38 kinase inactivation abrogates apoptosis following B-cell receptor activation, whereas its silencing significantly decreases MYC levels and increases apoptosis.
22674419 Findings suggest a function of NDR1, which may regulate NF-kappaB activation by its kinase activity.
22142472 GSK-3beta inhibits full activation of STK38, and STK38 activation is required to prevent cell death in response to oxidative stress
21730291 Findings show a biological role for MICAL-1 in apoptosis and define a novel negative regulatory mechanism of MST-NDR signaling.
21262772 These findings establish a novel MST3-NDR-p21 axis as an important regulator of G(1)/S progression of mammalian cells.
More...

AA Sequence

MAMTGSTPCSSMSNHTKERVTMTKVTLENFYSNLIAQHEEREMRQKKLEKVMEEEGLKDEEKRLRRSAHA      1 - 70
RKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVGHIRAERDI     71 - 140
LVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIH    141 - 210
RDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAF    211 - 280
STVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPIS    281 - 350
EKAKDLILRFCCEWEHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILK    351 - 420
PTVATSNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK                             421 - 465
//

Text Mined References (54)

PMID Year Title
26387716 2015 The Pro-apoptotic STK38 Kinase Is a New Beclin1 Partner Positively Regulating Autophagy.
26057687 2015 Regulation of NDR1 activity by PLK1 ensures proper spindle orientation in mitosis.
25936524 2015 Serine-Threonine Kinase 38 regulates CDC25A stability and the DNA damage-induced G2/M checkpoint.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25601544 2015 NDR functions as a physiological YAP1 kinase in the intestinal epithelium.
25576923 2015 Sema6A and Mical1 control cell growth and survival of BRAFV600E human melanoma cells.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24928906 2014 Rassf5 and Ndr kinases regulate neuronal polarity through Par3 phosphorylation in a novel pathway.
24786771 2014 Phosphorylation-dephosphorylation cycle of HP1? governs accurate mitotic progression.
24747552 2014 Constitutively active NDR1-PIF kinase functions independent of MST1 and hMOB1 signalling.
More...