Property Summary

NCBI Gene PubMed Count 48
PubMed Score 23.20
PubTator Score 90.73

Knowledge Summary

Patent (16,458)

Expression

  Differential Expression (12)

Gene RIF (23)

AA Sequence

MAMTGSTPCSSMSNHTKERVTMTKVTLENFYSNLIAQHEEREMRQKKLEKVMEEEGLKDEEKRLRRSAHA      1 - 70
RKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVGHIRAERDI     71 - 140
LVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIH    141 - 210
RDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAF    211 - 280
STVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPIS    281 - 350
EKAKDLILRFCCEWEHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILK    351 - 420
PTVATSNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK                             421 - 465
//

Text Mined References (56)

PMID Year Title