Property Summary

NCBI Gene PubMed Count 15
PubMed Score 13.73
PubTator Score 14.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
active Crohn's disease 1.431 1.8e-03
Atopic dermatitis -2.900 1.7e-05
breast carcinoma -1.400 4.9e-16
cutaneous lupus erythematosus -1.300 1.7e-02
cystic fibrosis -1.439 5.7e-06
diabetes mellitus -1.300 6.0e-03
Duchenne muscular dystrophy 1.284 1.4e-07
ductal carcinoma in situ -1.500 2.2e-02
intraductal papillary-mucinous adenoma (... -3.000 1.1e-06
intraductal papillary-mucinous carcinoma... -2.100 1.1e-03
intraductal papillary-mucinous neoplasm ... -2.700 5.0e-04
invasive ductal carcinoma -2.000 2.2e-02
lung cancer -2.100 9.8e-04
malignant mesothelioma -3.200 3.2e-09
medulloblastoma, large-cell -1.100 9.8e-04
nasopharyngeal carcinoma 1.300 3.4e-03
non-small cell lung cancer 1.060 1.6e-05
ovarian cancer -2.800 4.3e-07
pituitary cancer -2.200 6.3e-07
psoriasis -1.400 1.6e-03

Gene RIF (4)

AA Sequence

MKVWLLLGLLLVHEALEDVTGQHLPKNKRPKEPGENRIKPTNKKVKPKIPKMKDRDSANSAPKTQSIMMQ      1 - 70
VLDKGRFQKPAATLSLLAGQTVELRCKGSRIGWSYPAYLDTFKDSRLSVKQNERYGQLTLVNSTSADTGE     71 - 140
FSCWVQLCSGYICRKDEAKTGSTYIFFTEKGELFVPSPSYFDVVYLNPDRQAVVPCRVTVLSAKVTLHRE    141 - 210
FPAKEIPANGTDIVYDMKRGFVYLQPHSEHQGVVYCRAEAGGRSQISVKYQLLYVAVPSGPPSTTILASS    211 - 280
NKVKSGDDISVLCTVLGEPDVEVEFTWIFPGQKDERPVTIQDTWRLIHRGLGHTTRISQSVITVEDFETI    281 - 350
DAGYYICTAQNLQGQTTVATTVEFS                                                 351 - 375
//

Text Mined References (17)

PMID Year Title