Tbio | Platelet-derived growth factor receptor-like protein |
This gene encodes a protein with significant sequence similarity to the ligand binding domain of platelet-derived growth factor receptor beta. Mutations in this gene, or deletion of a chromosomal segment containing this gene, are associated with sporadic hepatocellular carcinomas, colorectal cancers, and non-small cell lung cancers. This suggests this gene product may function as a tumor suppressor. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count |
---|---|
Colon Carcinoma | 25 |
Colorectal Cancer | 62 |
Colorectal Neoplasms | 217 |
Liver carcinoma | 217 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Perrault syndrome | 12 | 5.567 | 2.8 |
Disease | Target Count |
---|---|
Carcinoma of colon | 32 |
hepatocellular carcinoma | 550 |
Disease | log2 FC | p |
---|---|---|
malignant mesothelioma | -3.200 | 0.000 |
psoriasis | -1.500 | 0.000 |
cutaneous lupus erythematosus | -1.300 | 0.017 |
cystic fibrosis | -1.439 | 0.000 |
medulloblastoma, large-cell | -1.100 | 0.001 |
Duchenne muscular dystrophy | 1.284 | 0.000 |
Atopic dermatitis | -2.900 | 0.000 |
non-small cell lung cancer | 1.060 | 0.000 |
intraductal papillary-mucinous adenoma (... | -3.000 | 0.000 |
intraductal papillary-mucinous carcinoma... | -2.100 | 0.001 |
intraductal papillary-mucinous neoplasm ... | -2.700 | 0.001 |
lung cancer | -2.100 | 0.001 |
active Crohn's disease | 1.431 | 0.002 |
diabetes mellitus | -1.300 | 0.006 |
nasopharyngeal carcinoma | 1.300 | 0.003 |
breast carcinoma | -1.400 | 0.000 |
ductal carcinoma in situ | -1.500 | 0.022 |
invasive ductal carcinoma | -2.000 | 0.022 |
ovarian cancer | -2.800 | 0.000 |
pituitary cancer | -2.200 | 0.000 |
Accession | Q15198 A8K085 Q6FH04 PDGFR-like protein |
Symbols |
PDGRL PRLTS |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG |
Opossum | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG |
Chicken | OMA EggNOG Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
23944365 | review elucidates the role of tumor stroma interactions, the roles of PDGF receptor signaling in cancer-associated fibroblasts via alteration of stromal matrix composition and the mitogenic effects of cancer-derived PDGFs. |
22926996 | Data indicate the association between SNP rs17633132:C/T in PDGFRL with Behcet disease and suggest that the PDGFRL gene may be involved in Behcet disease by modulating its transcription. |
20333786 | Results indicate that PDGFRL functions as a tumor suppressor, inhibiting the growth of colorectal cancer cells. |
20237496 | Observational study of gene-disease association. (HuGE Navigator) |
MKVWLLLGLLLVHEALEDVTGQHLPKNKRPKEPGENRIKPTNKKVKPKIPKMKDRDSANSAPKTQSIMMQ 1 - 70 VLDKGRFQKPAATLSLLAGQTVELRCKGSRIGWSYPAYLDTFKDSRLSVKQNERYGQLTLVNSTSADTGE 71 - 140 FSCWVQLCSGYICRKDEAKTGSTYIFFTEKGELFVPSPSYFDVVYLNPDRQAVVPCRVTVLSAKVTLHRE 141 - 210 FPAKEIPANGTDIVYDMKRGFVYLQPHSEHQGVVYCRAEAGGRSQISVKYQLLYVAVPSGPPSTTILASS 211 - 280 NKVKSGDDISVLCTVLGEPDVEVEFTWIFPGQKDERPVTIQDTWRLIHRGLGHTTRISQSVITVEDFETI 281 - 350 DAGYYICTAQNLQGQTTVATTVEFS 351 - 375 //
PMID | Year | Title |
---|---|---|
24529757 | 2014 | Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations. |
24324551 | 2013 | Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects. |
23944365 | 2014 | PDGF/PDGFR signaling and targeting in cancer growth and progression: Focus on tumor microenvironment and cancer-associated fibroblasts. |
22926996 | 2013 | Genetic variant on PDGFRL associated with Behçet disease in Chinese Han populations. |
20333786 | 2010 | Expression and functional characterization of platelet-derived growth factor receptor-like gene. |
20237496 | 2010 | New genetic associations detected in a host response study to hepatitis B vaccine. |
19815557 | 2009 | Cytoplasmic ACK1 interaction with multiple receptor tyrosine kinases is mediated by Grb2: an analysis of ACK1 effects on Axl signaling. |
18442402 | 2008 | The gene expression profiles of primary and metastatic melanoma yields a transition point of tumor progression and metastasis. |
18366601 | 2008 | An integrative approach to characterize disease-specific pathways and their coordination: a case study in cancer. |
16552773 | 2006 | Genetic background of different cancer cell lines influences the gene set involved in chromosome 8 mediated breast tumor suppression. |
More... |