Property Summary

NCBI Gene PubMed Count 15
PubMed Score 13.54
PubTator Score 14.33

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
23944365 review elucidates the role of tumor stroma interactions, the roles of PDGF receptor signaling in cancer-associated fibroblasts via alteration of stromal matrix composition and the mitogenic effects of cancer-derived PDGFs.
22926996 Data indicate the association between SNP rs17633132:C/T in PDGFRL with Behcet disease and suggest that the PDGFRL gene may be involved in Behcet disease by modulating its transcription.
20333786 Results indicate that PDGFRL functions as a tumor suppressor, inhibiting the growth of colorectal cancer cells.
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKVWLLLGLLLVHEALEDVTGQHLPKNKRPKEPGENRIKPTNKKVKPKIPKMKDRDSANSAPKTQSIMMQ      1 - 70
VLDKGRFQKPAATLSLLAGQTVELRCKGSRIGWSYPAYLDTFKDSRLSVKQNERYGQLTLVNSTSADTGE     71 - 140
FSCWVQLCSGYICRKDEAKTGSTYIFFTEKGELFVPSPSYFDVVYLNPDRQAVVPCRVTVLSAKVTLHRE    141 - 210
FPAKEIPANGTDIVYDMKRGFVYLQPHSEHQGVVYCRAEAGGRSQISVKYQLLYVAVPSGPPSTTILASS    211 - 280
NKVKSGDDISVLCTVLGEPDVEVEFTWIFPGQKDERPVTIQDTWRLIHRGLGHTTRISQSVITVEDFETI    281 - 350
DAGYYICTAQNLQGQTTVATTVEFS                                                 351 - 375
//

Text Mined References (17)

PMID Year Title
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23944365 2014 PDGF/PDGFR signaling and targeting in cancer growth and progression: Focus on tumor microenvironment and cancer-associated fibroblasts.
22926996 2013 Genetic variant on PDGFRL associated with Behçet disease in Chinese Han populations.
20333786 2010 Expression and functional characterization of platelet-derived growth factor receptor-like gene.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19815557 2009 Cytoplasmic ACK1 interaction with multiple receptor tyrosine kinases is mediated by Grb2: an analysis of ACK1 effects on Axl signaling.
18442402 2008 The gene expression profiles of primary and metastatic melanoma yields a transition point of tumor progression and metastasis.
18366601 2008 An integrative approach to characterize disease-specific pathways and their coordination: a case study in cancer.
16552773 2006 Genetic background of different cancer cell lines influences the gene set involved in chromosome 8 mediated breast tumor suppression.
More...