1. Home
  2. Targets
  3. receptor
  4. kinase
  5. protein kinase
  6. Platelet-derived growth factor receptor-like protein

Tbio Platelet-derived growth factor receptor-like protein

This gene encodes a protein with significant sequence similarity to the ligand binding domain of platelet-derived growth factor receptor beta. Mutations in this gene, or deletion of a chromosomal segment containing this gene, are associated with sporadic hepatocellular carcinomas, colorectal cancers, and non-small cell lung cancers. This suggests this gene product may function as a tumor suppressor. [provided by RefSeq, Jul 2008]

 Comments

Property Summary

NCBI Gene PubMed Count 15
PubMed Score 13.54
PubTator Score 14.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
psoriasis 6685 1.12027320783748E-49
breast carcinoma 1614 4.92504918382869E-16
malignant mesothelioma 3163 3.18509163750309E-9
Duchenne muscular dystrophy 602 1.35425298205548E-7
ovarian cancer 8492 4.27692788547763E-7
pituitary cancer 1972 6.33540638442981E-7
intraductal papillary-mucinous adenoma (IPMA) 2956 1.12478881472956E-6
cystic fibrosis 1670 5.69481791310296E-6
non-small cell lung cancer 2798 1.64824984693804E-5
Atopic dermatitis 944 1.74708180740356E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 5.02250045956635E-4
lung cancer 4473 9.83473451842088E-4
medulloblastoma, large-cell 6234 9.8398879969497E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00110073283233106
active Crohn's disease 918 0.00178063925295904
nasopharyngeal carcinoma 1056 0.00342187899392598
diabetes mellitus 1663 0.0060423901004013
cutaneous lupus erythematosus 1056 0.0169532530805828
invasive ductal carcinoma 2950 0.0218040098268777
ductal carcinoma in situ 1745 0.0218463246007277
Disease Target Count Z-score Confidence
Perrault syndrome 12 5.567 2.8

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma -3.200 0.000
psoriasis -1.500 0.000
cutaneous lupus erythematosus -1.300 0.017
cystic fibrosis -1.439 0.000
medulloblastoma, large-cell -1.100 0.001
Duchenne muscular dystrophy 1.284 0.000
Atopic dermatitis -2.900 0.000
non-small cell lung cancer 1.060 0.000
intraductal papillary-mucinous adenoma (... -3.000 0.000
intraductal papillary-mucinous carcinoma... -2.100 0.001
intraductal papillary-mucinous neoplasm ... -2.700 0.001
lung cancer -2.100 0.001
active Crohn's disease 1.431 0.002
diabetes mellitus -1.300 0.006
nasopharyngeal carcinoma 1.300 0.003
breast carcinoma -1.400 0.000
ductal carcinoma in situ -1.500 0.022
invasive ductal carcinoma -2.000 0.022
ovarian cancer -2.800 0.000
pituitary cancer -2.200 0.000

Synonym

Accession Q15198 A8K085 Q6FH04 PDGFR-like protein
Symbols PDGRL
PRLTS

Gene

PDGFRL

PANTHER Protein Class (3)

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GO Function (2)

 GO Component (1)

 Compartment GO Term (5)

 GWAS Trait (3)

 HCA RNA Cell Line (49)

See all...

Pathway (1)

 UniProt Keyword (9)

Gene RIF (4)

PMID Text
23944365 review elucidates the role of tumor stroma interactions, the roles of PDGF receptor signaling in cancer-associated fibroblasts via alteration of stromal matrix composition and the mitogenic effects of cancer-derived PDGFs.
22926996 Data indicate the association between SNP rs17633132:C/T in PDGFRL with Behcet disease and suggest that the PDGFRL gene may be involved in Behcet disease by modulating its transcription.
20333786 Results indicate that PDGFRL functions as a tumor suppressor, inhibiting the growth of colorectal cancer cells.
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence 

MKVWLLLGLLLVHEALEDVTGQHLPKNKRPKEPGENRIKPTNKKVKPKIPKMKDRDSANSAPKTQSIMMQ      1 - 70
VLDKGRFQKPAATLSLLAGQTVELRCKGSRIGWSYPAYLDTFKDSRLSVKQNERYGQLTLVNSTSADTGE     71 - 140
FSCWVQLCSGYICRKDEAKTGSTYIFFTEKGELFVPSPSYFDVVYLNPDRQAVVPCRVTVLSAKVTLHRE    141 - 210
FPAKEIPANGTDIVYDMKRGFVYLQPHSEHQGVVYCRAEAGGRSQISVKYQLLYVAVPSGPPSTTILASS    211 - 280
NKVKSGDDISVLCTVLGEPDVEVEFTWIFPGQKDERPVTIQDTWRLIHRGLGHTTRISQSVITVEDFETI    281 - 350
DAGYYICTAQNLQGQTTVATTVEFS                                                 351 - 375
//

Text Mined References (17)

PMID Year Title
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23944365 2014 PDGF/PDGFR signaling and targeting in cancer growth and progression: Focus on tumor microenvironment and cancer-associated fibroblasts.
22926996 2013 Genetic variant on PDGFRL associated with Behçet disease in Chinese Han populations.
20333786 2010 Expression and functional characterization of platelet-derived growth factor receptor-like gene.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19815557 2009 Cytoplasmic ACK1 interaction with multiple receptor tyrosine kinases is mediated by Grb2: an analysis of ACK1 effects on Axl signaling.
18442402 2008 The gene expression profiles of primary and metastatic melanoma yields a transition point of tumor progression and metastasis.
18366601 2008 An integrative approach to characterize disease-specific pathways and their coordination: a case study in cancer.
16552773 2006 Genetic background of different cancer cell lines influences the gene set involved in chromosome 8 mediated breast tumor suppression.
More...