Property Summary

NCBI Gene PubMed Count 5
PubMed Score 5412.91
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q15195
Symbols PRGA
PLGP2
PLGLA1

Gene

 GO Component (1)

AA Sequence

MEHKEVVLLLLLFLKSGQGEPLDDYVNAQGASLFSVTKKQLGAGSREECAAKCEEDKEFTCRAFQYHSKE      1 - 70
QQCVIMAENKKSSIIIRMRDVVLFEK                                                 71 - 96
//

Text Mined References (5)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
10092845 1999 Homologous plasminogen N-terminal and plasminogen-related gene A and B peptides. Characterization of cDNAs and recombinant fusion proteins.
9074645 1997 Characterization of the 5'-flanking regions of plasminogen-related genes A and B.
1986355 1991 Two types of abnormal genes for plasminogen in families with a predisposition for thrombosis.
1554698 1992 Multiple members of the plasminogen-apolipoprotein(a) gene family associated with thrombosis.