Property Summary

NCBI Gene PubMed Count 67
PubMed Score 59.31
PubTator Score 278.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 3.08990882853211E-4
Multiple myeloma 1328 4.63015546764901E-4
lung cancer 4473 0.00837936268566587
Waldenstrons macroglobulinemia 765 0.0166165134600938
Disease Target Count Z-score Confidence
Eye disease 55 0.0 1.0

Expression

  Differential Expression (4)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.245 0.017
Multiple myeloma 1.480 0.000
lung cancer 1.300 0.008
ovarian cancer -1.400 0.000

Synonym

Accession Q15185 A8K7D0 B4DHP2 B4DP11 B4DP21 Q8WU70
Symbols P23
TEBP
cPGES

Gene

PANTHER Protein Class (1)

PDB

1EJF   1LG0  

  Ortholog (11)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid

Gene RIF (29)

PMID Text
26151834 Even if p23 predominantly binds the Hsp90 dimer, p23 is also able to interact with Hsp90 oligomers, shifting the Hsp90 dimer-oligomers equilibrium toward dimer.
25241147 increased p23 expression may allow cells to acquire a more aggressive phenotype, contributing to disease progression
23741051 FKBP4, p23, and Aha1 cooperatively regulate the progression of hAgo2 through the chaperone cycle.
23413029 p23 recruits PHD2 to the HSP90 machinery to facilitate HIF-1alpha hydroxylation
22899854 The effects of p23 on androgen receptor (AR) activity are at least partly HSP90 independent, a mutant form of p23, unable to bind HSP90, increases AR activity.
22759865 p23 co-chaperone protects the aryl hydrocarbon receptor from degradation
22677230 As an anti-apoptotic factor, p23 is able to be a potential target for anti-leukemic therapy.
22277657 In cytosol only one protein called p23 hsp90 binds to Bax but the binding protein does not affect the subcellular localization and pro-apoptotic activity of Bax.
22190034 HIV-1 Rev interacting protein, prostaglandin E synthase 3 (PTGES3), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
22174317 HIV-1 Rev interacting protein, prostaglandin E synthase 3 (PTGES3), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
More...

AA Sequence

MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTD      1 - 70
RSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPE     71 - 140
VDGADDDSQDSDDEKMPDLE                                                      141 - 160
//

Text Mined References (86)

PMID Year Title
27353360 2016 The FNIP co-chaperones decelerate the Hsp90 chaperone cycle and enhance drug binding.
26151834 2015 Hsp90 oligomerization process: How can p23 drive the chaperone machineries?
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25241147 2015 The co-chaperone p23 promotes prostate cancer motility and metastasis.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24711448 2014 Defective Tibetan PHD2 binding to p23 links high altitude adaption to altered oxygen sensing.
24345775 2013 Dysregulation of glucocorticoid receptor co-factors FKBP5, BAG1 and PTGES3 in prefrontal cortex in psychotic illness.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23741051 2013 Hsp90 cochaperones p23 and FKBP4 physically interact with hAgo2 and activate RNA interference-mediated silencing in mammalian cells.
23413029 2013 Prolyl hydroxylase domain protein 2 (PHD2) binds a Pro-Xaa-Leu-Glu motif, linking it to the heat shock protein 90 pathway.
More...