Property Summary

NCBI Gene PubMed Count 70
PubMed Score 64.91
PubTator Score 278.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 3.1e-04
Multiple myeloma 1332 4.6e-04
lung cancer 4740 8.4e-03
Waldenstrons macroglobulinemia 765 1.7e-02
Disease Target Count Z-score Confidence
Eye disease 62 0.0 1.4

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.300 8.4e-03
Multiple myeloma 1.480 4.6e-04
ovarian cancer -1.400 3.1e-04
Waldenstrons macroglobulinemia 1.245 1.7e-02

Protein-protein Interaction (2)

Gene RIF (30)

AA Sequence

MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTD      1 - 70
RSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPE     71 - 140
VDGADDDSQDSDDEKMPDLE                                                      141 - 160
//

Text Mined References (90)

PMID Year Title