Property Summary

NCBI Gene PubMed Count 33
Grant Count 610
R01 Count 413
Funding $61,580,071.65
PubMed Score 654.08
PubTator Score 433.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.917 0.000
psoriasis 1.100 0.000
colon cancer 1.600 0.022
diabetes mellitus -1.100 0.003
adult high grade glioma -1.100 0.000
ovarian cancer 1.300 0.030

Synonym

Accession Q15181 Q2M348 Q5SQT7 Q6P7P4 Q9UQJ5 Q9Y5B1
Symbols PP
PP1
IOPPP
HEL-S-66p
SID6-8061

Gene

PANTHER Protein Class (2)

Gene RIF (13)

PMID Text
26869028 The Newcastle disease virus-induced translation shutoff at late infection times was attributed to sustaining phosphorylation of eIF2a, which is mediated by continual activation of PKR and degradation of PP1.
26722435 PPA1 may serve as a potential biomarker of poor prognosis in patients with gastric cancer
26378044 PP-1 and Akt have roles in AR-v7 protein expression and activities when AR is functionally blocked
25028520 findings indicate that brain PP-1I associates with and is regulated by the associated protein kinases C-TAK1 and PFTK1
25011106 Measles virus binding to DC-SIGN leads to inhibition of PP1 phosphatase activity and hence inhibition of RIG-I and Mda5 dephosphorylation.
25011105 The human PP1 interaction with the measles V protein is mediated by a conserved PP1-binding motif in the C-terminal region of the V protein.
23718219 PPP1R42 regulation of PP1 function in centrosome separation.
23215877 Results identify PP1 as a novel regulator of Cl(-)-HCO3(-) anion exchangers activity which, in concert with CFTR, coordinates events at both apical and basolateral membranes, crucial for efficient HCO3(-) secretion from Calu-3 cells.
22797819 Pyrophosphatase overexpression is associated with invasion, metastasis and recurrence in gastric cancer
21514157 PP1gamma is the major histone H3 phosphatase acting on the mitotically phosphorylated residues H3T3ph, H3S10ph, H3T11ph, and H3S28ph.
More...

AA Sequence

MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIK      1 - 70
QDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSKVCARGEIIGVKV     71 - 140
LGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEF    141 - 210
KDKDFAIDIIKSTHDHWKALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDV    211 - 280
DKWFHHQKN                                                                 281 - 289
//

Text Mined References (41)

PMID Year Title
26869028 2016 Regulation of de novo translation of host cells by manipulation of PERK/PKR and GADD34-PP1 activity during Newcastle disease virus infection.
26722435 2015 Inorganic pyrophosphatase (PPA1) is a negative prognostic marker for human gastric cancer.
26378044 2015 AR-v7 protein expression is regulated by protein kinase and phosphatase.
25028520 2014 Regulation of protein phosphatase 1I by Cdc25C-associated kinase 1 (C-TAK1) and PFTAIRE protein kinase.
25011106 2014 Measles virus suppresses RIG-I-like receptor activation in dendritic cells via DC-SIGN-mediated inhibition of PP1 phosphatases.
25011105 2014 Antagonism of the phosphatase PP1 by the measles virus V protein is required for innate immune escape of MDA5.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23718219 2013 PPP1R42, a PP1 binding protein, regulates centrosome dynamics in ARPE-19 cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23215877 2013 Protein phosphatase 1 coordinates CFTR-dependent airway epithelial HCO3- secretion by reciprocal regulation of apical and basolateral membrane Cl(-)-HCO3- exchangers.
More...