Property Summary

NCBI Gene PubMed Count 23
PubMed Score 2.64
PubTator Score 6.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma -1.300 5.9e-06
Astrocytoma, Pilocytic -1.200 3.4e-09
atypical teratoid / rhabdoid tumor -1.400 4.4e-08
ependymoma -1.200 1.7e-12
glioblastoma -1.200 2.7e-10
medulloblastoma, large-cell -1.100 1.0e-03

Gene RIF (14)

AA Sequence

METKLPPASTPTSPSSPGLSPVPPPDKVDGFSRRSLRRARPRRSHSSSQFRYQSNQQELTPLPLLKDVPA      1 - 70
SELHELLSRKLAQCGVMFDFLDCVADLKGKEVKRAALNELVECVGSTRGVLIEPVYPDIIRMISVNIFRT     71 - 140
LPPSENPEFDPEEDEPNLEPSWPHLQLVYEFFLRFLESPDFQPSVAKRYVDQKFVLMLLELFDSEDPRER    141 - 210
EYLKTILHRVYGKFLGLRAYIRKQCNHIFLRFIYEFEHFNGVAELLEILGSIINGFALPLKTEHKQFLVR    211 - 280
VLIPLHSVKSLSVFHAQLAYCVVQFLEKDATLTEHVIRGLLKYWPKTCTQKEVMFLGEMEEILDVIEPSQ    281 - 350
FVKIQEPLFKQVARCVSSPHFQVAERALYFWNNEYILSLIEDNCHTVLPAVFGTLYQVSKEHWNQTIVSL    351 - 420
IYNVLKTFMEMNGKLFDELTASYKLEKQQEQQKAQERQELWQGLEELRLRRLQGTQGAKEAPLQRLTPQV    421 - 490
AASGGQS                                                                   491 - 497
//

Text Mined References (26)

PMID Year Title