Property Summary

NCBI Gene PubMed Count 48
PubMed Score 1.92
PubTator Score 13.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
group 3 medulloblastoma 2254 7.80634405087864E-7
medulloblastoma, large-cell 6234 8.05844325100931E-5
osteosarcoma 7933 2.29908191536651E-4
primitive neuroectodermal tumor 3031 2.99602183296967E-4
lung cancer 4473 3.94410476887E-4
ovarian cancer 8492 9.25296274392443E-4
adult high grade glioma 2148 0.00111012986538257
Disease Target Count Z-score Confidence
Ameloblastoma 25 3.026 1.5

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.283 0.000
group 3 medulloblastoma -2.100 0.000
medulloblastoma, large-cell -1.600 0.000
primitive neuroectodermal tumor -1.100 0.000
lung cancer -1.300 0.000
adult high grade glioma -1.100 0.001
ovarian cancer 1.300 0.001

Synonym

Accession Q15172 B2R6D2 B7Z7L2 D3DT99 Q2NL72 Q5VVB2 Q8TBI9
Symbols B56A
PR61A

Gene

  Ortholog (10)

Gene RIF (20)

PMID Text
25505242 The interaction of HIV-1 CA with human cellular protein phosphatase 2, regulatory subunit B', alpha (PPP2R5A) is identified by yeast two-hybrid screen
24225947 results suggest that PKCalpha can modify PP2A activity by phosphorylation of B56alpha at Ser(41). This interplay between PKCalpha and PP2A represents a new mechanism to regulate important cellular functions like cellular Ca(2+) homeostasis.
23955003 PP2A regulatory subunit Balpha controls endothelial contractility and vessel lumen integrity via regulation of HDAC7.
23287597 The interaction of HIV-1 CA with human cellular protein phosphatase 2, regulatory subunit B', alpha (PPP2R5A) is identified by yeast two-hybrid screen
21878643 reversible phosphorylation of Dzip1, which is controlled by the antagonistic action of CK2 and B56-containing PP2As, has an important impact on the stability of Gli transcription factors and Hh signaling.
21874008 Reveal that PPP2R5A, an essential tumour suppressor, tunes the balance of phosphorylation to promote chromosome-spindle interactions during cell division.
21351466 The interaction of HIV-1 CA with human cellular protein phosphatase 2, regulatory subunit B', alpha (PPP2R5A) is identified by yeast two-hybrid screen
21075214 The PP2A-B'alpha holoenzyme appears to function as an important endogenous regulator of SK1.
21072166 The interaction of HIV-1 CA with human cellular protein phosphatase 2, regulatory subunit B', alpha (PPP2R5A) is identified by yeast two-hybrid screen
21030067 Following TGF-beta1 treatment, recruitment of PP2A-Balpha by TbetaRI increased in benign cells, but not in malignant cells. Inhibition of PP2A in benign cells resulted in an increase in ERK activation and in TGF-beta1 auto-induction after TGF-beta1 treatment.
More...

AA Sequence

MSSSSPPAGAASAAISASEKVDGFTRKSVRKAQRQKRSQGSSQFRSQGSQAELHPLPQLKDATSNEQQEL      1 - 70
FCQKLQQCCILFDFMDSVSDLKSKEIKRATLNELVEYVSTNRGVIVESAYSDIVKMISANIFRTLPPSDN     71 - 140
PDFDPEEDEPTLEASWPHIQLVYEFFLRFLESPDFQPSIAKRYIDQKFVQQLLELFDSEDPRERDFLKTV    141 - 210
LHRIYGKFLGLRAFIRKQINNIFLRFIYETEHFNGVAELLEILGSIINGFALPLKAEHKQFLMKVLIPMH    211 - 280
TAKGLALFHAQLAYCVVQFLEKDTTLTEPVIRGLLKFWPKTCSQKEVMFLGEIEEILDVIEPTQFKKIEE    281 - 350
PLFKQISKCVSSSHFQVAERALYFWNNEYILSLIEENIDKILPIMFASLYKISKEHWNPTIVALVYNVLK    351 - 420
TLMEMNGKLFDDLTSSYKAERQREKKKELEREELWKKLEELKLKKALEKQNSAYNMHSILSNTSAE        421 - 486
//

Text Mined References (56)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24225947 2014 Protein phosphatase 2A is regulated by protein kinase C? (PKC?)-dependent phosphorylation of its targeting subunit B56? at Ser41.
23955003 2013 PP2A regulatory subunit B? controls endothelial contractility and vessel lumen integrity via regulation of HDAC7.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21878643 2011 The antagonistic action of B56-containing protein phosphatase 2As and casein kinase 2 controls the phosphorylation and Gli turnover function of Daz interacting protein 1.
21874008 2011 Formation of stable attachments between kinetochores and microtubules depends on the B56-PP2A phosphatase.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...