Property Summary

Ligand Count 3
NCBI Gene PubMed Count 53
PubMed Score 3.09
PubTator Score 13.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Emphysema 12 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.100 1.1e-03
group 3 medulloblastoma -2.100 7.8e-07
lung cancer -1.300 3.9e-04
medulloblastoma, large-cell -1.600 8.1e-05
osteosarcoma -1.283 2.3e-04
ovarian cancer 1.300 9.3e-04
primitive neuroectodermal tumor -1.100 3.0e-04

Gene RIF (24)

AA Sequence

MSSSSPPAGAASAAISASEKVDGFTRKSVRKAQRQKRSQGSSQFRSQGSQAELHPLPQLKDATSNEQQEL      1 - 70
FCQKLQQCCILFDFMDSVSDLKSKEIKRATLNELVEYVSTNRGVIVESAYSDIVKMISANIFRTLPPSDN     71 - 140
PDFDPEEDEPTLEASWPHIQLVYEFFLRFLESPDFQPSIAKRYIDQKFVQQLLELFDSEDPRERDFLKTV    141 - 210
LHRIYGKFLGLRAFIRKQINNIFLRFIYETEHFNGVAELLEILGSIINGFALPLKAEHKQFLMKVLIPMH    211 - 280
TAKGLALFHAQLAYCVVQFLEKDTTLTEPVIRGLLKFWPKTCSQKEVMFLGEIEEILDVIEPTQFKKIEE    281 - 350
PLFKQISKCVSSSHFQVAERALYFWNNEYILSLIEENIDKILPIMFASLYKISKEHWNPTIVALVYNVLK    351 - 420
TLMEMNGKLFDDLTSSYKAERQREKKKELEREELWKKLEELKLKKALEKQNSAYNMHSILSNTSAE        421 - 486
//

Text Mined References (61)

PMID Year Title