Property Summary

NCBI Gene PubMed Count 20
PubMed Score 20.06
PubTator Score 18.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 3.53727761553503E-23
ovarian cancer 8492 6.83173472222193E-10
atypical teratoid / rhabdoid tumor 4369 1.13134882063017E-6
medulloblastoma 1524 6.86183459524804E-5
glioblastoma 5572 1.63048348353227E-4
medulloblastoma, large-cell 6234 1.75901115822944E-4
osteosarcoma 7933 2.70723256208761E-4

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.867 0.000
atypical teratoid / rhabdoid tumor -1.200 0.000
glioblastoma -1.100 0.000
medulloblastoma -1.100 0.000
medulloblastoma, large-cell -1.700 0.000
non-small cell lung cancer -1.003 0.000
ovarian cancer -1.600 0.000

Synonym

Accession Q15170 Q9UJQ9 TCEA-like protein 1
Symbols p21
SIIR
WEX9
pp21

Gene

PANTHER Protein Class (1)

  Ortholog (8)

Gene RIF (10)

PMID Text
19475409 Treatment with active matabolite of vitamin D (1alpha,25-dihydroxyvitamin D3) up-regulates mRNA expression of p21.
18640142 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16697770 Observational study of gene-disease association. (HuGE Navigator)
16542834 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16364249 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16331344 Observational study of gene-disease association. (HuGE Navigator)
16054204 Observational study of gene-disease association. (HuGE Navigator)
15807891 Observational study of gene-disease association. (HuGE Navigator)
15773840 There was a marked decrease in the levels of the transcriptional elongation factor A gene in squamous cell cancer compared to normal samples. Reduced expression of the TCEAL1 gene may be important in esophageal squamous cell carcinogenesis.
11248419 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDKPRKENEEEPQSRPRPMRRGLRWSTLPKSSPPRSSLRRSSPRRRSSFLRSSCLSSCLRCSSRRTPSAG      1 - 70
LSRKDLFEGRPPMEQPPCGVGKHKLEEGSFKERLARSRPQFRGDIHGRNLSNEEMIQAADELEEMKRVRN     71 - 140
KLMIMHWKAKRSRPYPI                                                         141 - 157
//

Text Mined References (22)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19475409 2010 Treatment of K562 cells with 1,25-dihydroxyvitamin D3 induces distinct alterations in the expression of apoptosis-related genes BCL2, BAX, BCLXL, and p21.
18640142 2008 Polymorphisms in cell cycle regulatory genes, urinary arsenic profile and urothelial carcinoma.
16697770 2006 Polymorphisms of p53 and p21 genes in chronic obstructive pulmonary disease.
16542834 2006 Linking TP53 codon 72 and P21 nt590 genotypes to the development of cervical and ovarian cancer.
16364249 2006 TP53 and P21 polymorphisms: response to cisplatinum/paclitaxel-based chemotherapy in ovarian cancer.
16341674 2005 Transcriptome analysis of human gastric cancer.
16331344 2006 Association between TP53 and p21 genetic polymorphisms and acute side effects of radiotherapy in breast cancer patients.
16221301 2005 Mammalian BEX, WEX and GASP genes: coding and non-coding chimaerism sustained by gene conversion events.
More...