Property Summary

NCBI Gene PubMed Count 20
PubMed Score 22.19
PubTator Score 18.28

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 1.1e-06
glioblastoma -1.100 1.6e-04
medulloblastoma -1.100 6.9e-05
medulloblastoma, large-cell -1.700 1.8e-04
non-small cell lung cancer -1.003 3.5e-23
osteosarcoma 1.867 2.7e-04
ovarian cancer -1.600 6.8e-10

Gene RIF (10)

AA Sequence

MDKPRKENEEEPQSRPRPMRRGLRWSTLPKSSPPRSSLRRSSPRRRSSFLRSSCLSSCLRCSSRRTPSAG      1 - 70
LSRKDLFEGRPPMEQPPCGVGKHKLEEGSFKERLARSRPQFRGDIHGRNLSNEEMIQAADELEEMKRVRN     71 - 140
KLMIMHWKAKRSRPYPI                                                         141 - 157
//

Text Mined References (22)

PMID Year Title