Property Summary

NCBI Gene PubMed Count 67
Grant Count 41
R01 Count 21
Funding $3,001,398.37
PubMed Score 60.06
PubTator Score 69.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (56)

PMID Text
26227792 PON3 SNP rs13226149 was associated with intracerebral hemorrhage in log-additive and dominant models. The A allele of rs13226149 contributed to the decreased risk of ICH. SNP rs1053275 was not associated with ICH.
25964115 Interaction of PON-3 and PON-1 and HDL are associated with the presence and severity of coronary artery disease in type 2 diabetes mellitus patients.
25953737 Data suggest cigarette smoke leads to inhibition of hydrolytic activity of paraoxonase isoenzymes (PON1, PON2, PON3) by modification of thiol groups, by interactions with free radicals/heavy metals, or by decreasing HDL level in blood. [REVIEW]
25723336 PON3 in HDL may be an important protein in preventing atherosclerosis.
25505242 The interaction of HIV-1 CA with human cellular paraoxonase 3 protein (PON3) is identified by yeast two-hybrid screen
25038992 PON2 and PON3 (i) are associated with mitochondria and mitochondria-associated membranes, (ii) modulate mitochondria-dependent superoxide production, and (iii) prevent apoptosis.
22441669 PON3 is upregulated in cancer tissues and protects against mitochondrial superoxide-mediated cell death.
22153698 Increased serum paraoxonase-3 concentration is associated with insulin sensitivity in peripheral artery disease and with inflammation in coronary artery disease.
22003209 This study reports for the first time an important increase in serum PON3 concentrations in HIV-infected patients that is associated with their oxidative status and their treatment with NNRTI.
21952037 investigation of whether gene silencing of Pon3 causes oxidative stress in cell line: Data suggest that PON3 knockdown reduces cell proliferation and total antioxidant capacity at ambient oxygen levels.
More...

AA Sequence

MGKLVALVLLGVGLSLVGEMFLAFRERVNASREVEPVEPENCHLIEELESGSEDIDILPSGLAFISSGLK      1 - 70
YPGMPNFAPDEPGKIFLMDLNEQNPRAQALEISGGFDKELFNPHGISIFIDKDNTVYLYVVNHPHMKSTV     71 - 140
EIFKFEEQQRSLVYLKTIKHELLKSVNDIVVLGPEQFYATRDHYFTNSLLSFFEMILDLRWTYVLFYSPR    141 - 210
EVKVVAKGFCSANGITVSADQKYVYVADVAAKNIHIMEKHDNWDLTQLKVIQLGTLVDNLTVDPATGDIL    211 - 280
AGCHPNPMKLLNYNPEDPPGSEVLRIQNVLSEKPRVSTVYANNGSVLQGTSVASVYHGKILIGTVFHKTL    281 - 350
YCEL                                                                      351 - 354
//

Text Mined References (69)

PMID Year Title
26227792 2015 Association Between Paraoxonase Gene Polymorphisms and Intracerebral Hemorrhage in a Korean Population.
25964115 2015 Association of elevated apoA-I glycation and reduced HDL-associated paraoxonase1, 3 activity, and their interaction with angiographic severity of coronary artery disease in patients with type 2 diabetes mellitus.
25953737 Paraoxonase activity as a marker of exposure to xenobiotics in tobacco smoke.
25723336 2015 Paraoxonase-3 is depleted from the high-density lipoproteins of autoimmune disease patients with subclinical atherosclerosis.
25038992 2014 Inflammation, infection, cancer and all that…the role of paraoxonases.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22441669 2012 PON3 is upregulated in cancer tissues and protects against mitochondrial superoxide-mediated cell death.
22153698 2012 Serum paraoxonase-3 concentration is associated with insulin sensitivity in peripheral artery disease and with inflammation in coronary artery disease.
22003209 2012 Serum paraoxonase-3 concentration in HIV-infected patients. Evidence for a protective role against oxidation.
21952037 2012 Disruption of paraoxonase 3 impairs proliferation and antioxidant defenses in human A549 cells and causes embryonic lethality in mice.
More...