Property Summary

NCBI Gene PubMed Count 74
PubMed Score 64.72
PubTator Score 69.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adrenocortical carcinoma -1.311 1.5e-03
Atopic dermatitis -1.400 4.1e-03
cutaneous lupus erythematosus -1.400 4.5e-02
head and neck cancer -1.200 3.8e-02
head and neck cancer and chronic obstruc... -1.100 1.3e-02
interstitial cystitis -1.400 5.9e-03
lung carcinoma 3.100 1.1e-27
non-small cell lung cancer -1.238 4.6e-06
osteosarcoma -1.633 6.2e-03
ovarian cancer -1.100 6.3e-03
pancreatic ductal adenocarcinoma liver m... -3.021 7.4e-03
pituitary cancer -3.500 1.6e-03

Gene RIF (63)

AA Sequence

MGKLVALVLLGVGLSLVGEMFLAFRERVNASREVEPVEPENCHLIEELESGSEDIDILPSGLAFISSGLK      1 - 70
YPGMPNFAPDEPGKIFLMDLNEQNPRAQALEISGGFDKELFNPHGISIFIDKDNTVYLYVVNHPHMKSTV     71 - 140
EIFKFEEQQRSLVYLKTIKHELLKSVNDIVVLGPEQFYATRDHYFTNSLLSFFEMILDLRWTYVLFYSPR    141 - 210
EVKVVAKGFCSANGITVSADQKYVYVADVAAKNIHIMEKHDNWDLTQLKVIQLGTLVDNLTVDPATGDIL    211 - 280
AGCHPNPMKLLNYNPEDPPGSEVLRIQNVLSEKPRVSTVYANNGSVLQGTSVASVYHGKILIGTVFHKTL    281 - 350
YCEL                                                                      351 - 354
//

Text Mined References (76)

PMID Year Title