Property Summary

NCBI Gene PubMed Count 178
PubMed Score 154.35
PubTator Score 176.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
medulloblastoma, large-cell 6234 2.59421041493565E-7
group 4 medulloblastoma 1875 4.37417987080942E-7
osteosarcoma 7933 8.10287840018199E-7
malignant mesothelioma 3163 3.64255838514755E-6
psoriasis 6685 1.00142102331515E-5
ovarian cancer 8492 1.28243338943434E-5
tuberculosis and treatment for 3 months 327 1.55083107548291E-5
Down syndrome 548 4.17744909317986E-4
lung adenocarcinoma 2714 4.58221947807644E-4
Pick disease 1893 5.79627035922758E-4
lung cancer 4473 0.0036551256706951
primary pancreatic ductal adenocarcinoma 1271 0.00476701567456976
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00679592952290265
pancreatic cancer 2300 0.00981187427718267
esophageal adenocarcinoma 737 0.0222071034923008
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0224229061591194
Disease Target Count
Amyotrophic Lateral Sclerosis 432

Expression

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid

Gene RIF (195)

PMID Text
26656916 Data indicate the relationship between ubiqutination of lysine (Lys) 168 and paraoxonase 2 (PON2) catalytic activity.
26227792 PON2 SNPs rs12026 and rs7493 were associated with intracerebral hemorrhage. The C alleles of rs12026 and rs7493 contributed to a decreased risk of ICH.
26056385 PON2 is a central regulator of host cell responses to Pseudomonas aeruginosa N-(3-oxo-dodecanoyl)-L-homoserine lactone
25991559 Haplotype containing two risk alleles of PON1 and PON2 genes was significantly associated with disease diabetes mellitus, type 2.
25953737 Data suggest cigarette smoke leads to inhibition of hydrolytic activity of paraoxonase isoenzymes (PON1, PON2, PON3) by modification of thiol groups, by interactions with free radicals/heavy metals, or by decreasing HDL level in blood. [REVIEW]
25913154 Newborns with PON2 148AG/GG genotype and exposed to high concentrations of MBP and MEHP had higher risks of LBW and SBL
25740199 D1-like receptors inhibit ROS production by altering PON2 distribution in membrane microdomains in the short-term, and by increasing PON2 expression in the long-term.
25708945 PON2 levels reflect the cells' irradiation sensitivity.
25210784 Taken together, our data suggest a model by which DJ-1 exerts its antioxidant activities, at least partly through regulation of PON2.
25038992 PON2 and PON3 (i) are associated with mitochondria and mitochondria-associated membranes, (ii) modulate mitochondria-dependent superoxide production, and (iii) prevent apoptosis.
More...

AA Sequence

MGRLVAVGLLGIALALLGERLLALRNRLKASREVESVDLPHCHLIKGIEAGSEDIDILPNGLAFFSVGLK      1 - 70
FPGLHSFAPDKPGGILMMDLKEEKPRARELRISRGFDLASFNPHGISTFIDNDDTVYLFVVNHPEFKNTV     71 - 140
EIFKFEEAENSLLHLKTVKHELLPSVNDITAVGPAHFYATNDHYFSDPFLKYLETYLNLHWANVVYYSPN    141 - 210
EVKVVAEGFDSANGINISPDDKYIYVADILAHEIHVLEKHTNMNLTQLKVLELDTLVDNLSIDPSSGDIW    211 - 280
VGCHPNGQKLFVYDPNNPPSSEVLRIQNILCEKPTVTTVYANNGSVLQGSSVASVYDGKLLIGTLYHRAL    281 - 350
YCEL                                                                      351 - 354
//

Text Mined References (183)

PMID Year Title
26656916 2015 An Engineered Version of Human PON2 Opens the Way to Understand the Role of Its Post-Translational Modifications in Modulating Catalytic Activity.
26227792 2015 Association Between Paraoxonase Gene Polymorphisms and Intracerebral Hemorrhage in a Korean Population.
26056385 2015 Novel Paraoxonase 2-Dependent Mechanism Mediating the Biological Effects of the Pseudomonas aeruginosa Quorum-Sensing Molecule N-(3-Oxo-Dodecanoyl)-L-Homoserine Lactone.
25991559 2015 Oxidative stress-related genes in type 2 diabetes: association analysis and their clinical impact.
25953737 Paraoxonase activity as a marker of exposure to xenobiotics in tobacco smoke.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25913154 2015 Paraoxonase 2 gene polymorphisms and prenatal phthalates' exposure in Chinese newborns.
25740199 2015 Dopamine D1 and D5 receptors differentially regulate oxidative stress through paraoxonase 2 in kidney cells.
25708945 2015 Paraoxonase-2 (PON2) protects oral squamous cell cancer cells against irradiation-induced apoptosis.
25210784 2014 DJ-1 interacts with and regulates paraoxonase-2, an enzyme critical for neuronal survival in response to oxidative stress.
More...