Property Summary

NCBI Gene PubMed Count 187
PubMed Score 162.90
PubTator Score 176.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Cardiovascular Diseases 59 0.0 0.0
Hyperlipoproteinemia Type II 12 0.0 0.0
Disease Target Count
Amyotrophic lateral sclerosis 451

Expression

  Differential Expression (16)

Disease log2 FC p
Down syndrome 1.800 4.2e-04
esophageal adenocarcinoma 1.100 2.2e-02
group 3 medulloblastoma -2.100 1.0e-06
intraductal papillary-mucinous carcinoma... 1.500 6.8e-03
intraductal papillary-mucinous neoplasm ... 1.500 2.2e-02
lung adenocarcinoma 1.324 4.6e-04
lung cancer 2.100 4.5e-05
malignant mesothelioma -1.100 3.6e-06
medulloblastoma, large-cell -2.800 1.9e-06
osteosarcoma 1.629 8.1e-07
ovarian cancer -1.500 4.3e-04
pancreatic cancer 1.100 1.0e-04
Pick disease 1.100 5.8e-04
primary pancreatic ductal adenocarcinoma 1.272 4.8e-03
psoriasis 1.100 1.0e-05
tuberculosis and treatment for 3 months 1.200 1.6e-05

Gene RIF (204)

AA Sequence

MGRLVAVGLLGIALALLGERLLALRNRLKASREVESVDLPHCHLIKGIEAGSEDIDILPNGLAFFSVGLK      1 - 70
FPGLHSFAPDKPGGILMMDLKEEKPRARELRISRGFDLASFNPHGISTFIDNDDTVYLFVVNHPEFKNTV     71 - 140
EIFKFEEAENSLLHLKTVKHELLPSVNDITAVGPAHFYATNDHYFSDPFLKYLETYLNLHWANVVYYSPN    141 - 210
EVKVVAEGFDSANGINISPDDKYIYVADILAHEIHVLEKHTNMNLTQLKVLELDTLVDNLSIDPSSGDIW    211 - 280
VGCHPNGQKLFVYDPNNPPSSEVLRIQNILCEKPTVTTVYANNGSVLQGSSVASVYDGKLLIGTLYHRAL    281 - 350
YCEL                                                                      351 - 354
//

Text Mined References (192)

PMID Year Title