Property Summary

NCBI Gene PubMed Count 79
Grant Count 28
R01 Count 11
Funding $3,584,909.17
PubMed Score 27.77
PubTator Score 71.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma 1.400 0.025
ependymoma 1.400 0.007
psoriasis -1.600 0.000
sonic hedgehog group medulloblastoma 1.200 0.000
atypical teratoid / rhabdoid tumor 1.300 0.000
medulloblastoma, large-cell 1.300 0.000
hereditary spastic paraplegia -1.066 0.007
colon cancer -1.400 0.044
lung cancer -1.100 0.003
lung adenocarcinoma -1.100 0.001
Breast cancer -2.000 0.000
breast carcinoma -1.200 0.000
invasive ductal carcinoma -1.500 0.010
ovarian cancer -2.200 0.000
chronic rhinosinusitis -1.270 0.008

 GO Function (1)

Gene RIF (26)

PMID Text
24913195 Haematological neoplasms associated with t(8;9)(p22;p24); PCM1-JAK2 have features in common and we suggest that they should be recognized as a specific entity in the WHO classification
24909162 a novel variant in the PCM1 3'UTR is significantly associated with ovarian cancer
24576429 no association between the PCM1 gene and schizophrenia in a Japanese population
23372669 Chromosomal translocation [t(8;9)(p22;p24)]/PCM1-JAK2 fusion protein activates SOCS2 and SOCS3 via STAT5 in a cutaneous T-cell lymphoma cell line.
23345402 these data suggest a mechanism whereby the recruitment of Plk1 to pericentriolar matrix by PCM1 plays a pivotal role in the regulation of primary cilia disassembly before mitotic entry.
23110211 CEP90 physically interacts with PCM-1 at centriolar satellites, and this interaction is essential for centrosomal accumulation of the centriolar satellites and eventually for primary cilia formation.
22100915 NEK7 is essential for PCM accumulation in a cell cycle stage-specific manner.
21998199 PCM1 interacts with Hook2 in a complex that regulates a limiting step required for further initiation of ciliogenesis after centriole maturation.
21985783 WT HTT regulates ciliogenesis by interacting through huntingtin-associated protein 1 (HAP1) with pericentriolar material 1 protein (PCM1).
21481569 The data failed to find a significant association between SNPs or haplotypes of the PCM1 gene and schizophrenia in the Japanese population (P>0.28).
More...

AA Sequence

MATGGGPFEDGMNDQDLPNWSNENVDDRLNNMDWGAQQKKANRSSEKNKKKFGVESDKRVTNDISPESSP      1 - 70
GVGRRRTKTPHTFPHSRYMSQMSVPEQAELEKLKQRINFSDLDQRSIGSDSQGRATAANNKRQLSENRKP     71 - 140
FNFLPMQINTNKSKDASTSPPNRETIGSAQCKELFASALSNDLLQNCQVSEEDGRGEPAMESSQIVSRLV    141 - 210
QIRDYITKASSMREDLVEKNERSANVERLTHLIDHLKEQEKSYMKFLKKILARDPQQEPMEEIENLKKQH    211 - 280
DLLKRMLQQQEQLRALQGRQAALLALQHKAEQAIAVMDDSVVAETAGSLSGVSITSELNEELNDLIQRFH    281 - 350
NQLRDSQPPAVPDNRRQAESLSLTREVSQSRKPSASERLPDEKVELFSKMRVLQEKKQKMDKLLGELHTL    351 - 420
RDQHLNNSSSSPQRSVDQRSTSAPSASVGLAPVVNGESNSLTSSVPYPTASLVSQNESENEGHLNPSEKL    421 - 490
QKLNEVRKRLNELRELVHYYEQTSDMMTDAVNENRKDEETEESEYDSEHENSEPVTNIRNPQVASTWNEV    491 - 560
NSHSNAQCVSNNRDGRTVNSNCEINNRSAANIRALNMPPSLDCRYNREGEQEIHVAQGEDDEEEEEEAEE    561 - 630
EGVSGASLSSHRSSLVDEHPEDAEFEQKINRLMAAKQKLRQLQDLVAMVQDDDAAQGVISASASNLDDFY    631 - 700
PAEEDTKQNSNNTRGNANKTQKDTGVNEKAREKFYEAKLQQQQRELKQLQEERKKLIDIQEKIQALQTAC    701 - 770
PDLQLSAASVGNCPTKKYMPAVTSTPTVNQHETSTSKSVFEPEDSSIVDNELWSEMRRHEMLREELRQRR    771 - 840
KQLEALMAEHQRRQGLAETASPVAVSLRSDGSENLCTPQQSRTEKTMATWGGSTQCALDEEGDEDGYLSE    841 - 910
GIVRTDEEEEEEQDASSNDNFSVCPSNSVNHNSYNGKETKNRWKNNCPFSADENYRPLAKTRQQNISMQR    911 - 980
QENLRWVSELSYVEEKEQWQEQINQLKKQLDFSVSICQTLMQDQQTLSCLLQTLLTGPYSVMPSNVASPQ    981 - 1050
VHFIMHQLNQCYTQLTWQQNNVQRLKQMLNELMRQQNQHPEKPGGKERGSSASHPPSPSLFCPFSFPTQP   1051 - 1120
VNLFNIPGFTNFSSFAPGMNFSPLFPSNFGDFSQNISTPSEQQQPLAQNSSGKTEYMAFPKPFESSSSIG   1121 - 1190
AEKPRNKKLPEEEVESSRTPWLYEQEGEVEKPFIKTGFSVSVEKSTSSNRKNQLDTNGRRRQFDEESLES   1191 - 1260
FSSMPDPVDPTTVTKTFKTRKASAQASLASKDKTPKSKSKKRNSTQLKSRVKNIRYESASMSSTCEPCKS   1261 - 1330
RNRHSAQTEEPVQAKVFSRKNHEQLEKIIKCNRSTEISSETGSDFSMFEALRDTIYSEVATLISQNESRP   1331 - 1400
HFLIELFHELQLLNTDYLRQRALYALQDIVSRHISESHEKGENVKSVNSGTWIASNSELTPSESLATTDD   1401 - 1470
ETFEKNFERETHKISEQNDADNASVLSVSSNFEPFATDDLGNTVIHLDQALARMREYERMKTEAESNSNM   1471 - 1540
RCTCRIIEDGDGAGAGTTVNNLEETPVIENRSSQQPVSEVSTIPCPRIDTQQLDRQIKAIMKEVIPFLKE   1541 - 1610
HMDEVCSSQLLTSVRRMVLTLTQQNDESKEFVKFFHKQLGSILQDSLAKFAGRKLKDCGEDLLVEISEVL   1611 - 1680
FNELAFFKLMQDLDNNSITVKQRCKRKIEATGVIQSCAKEAKRILEDHGSPAGEIDDEDKDKDETETVKQ   1681 - 1750
TQTSEVYDGPKNVRSDISDQEEDEESEGCPVSINLSKAETQALTNYGSGEDENEDEEMEEFEEGPVDVQT   1751 - 1820
SLQANTEATEENEHDEQVLQRDFKKTAESKNVPLEREATSKNDQNNCPVKPCYLNILEDEQPLNSAAHKE   1821 - 1890
SPPTVDSTQQPNPLPLRLPEMEPLVPRVKEVKSAQETPESSLAGSPDTESPVLVNDYEAESGNISQKSDE   1891 - 1960
EDFVKVEDLPLKLTIYSEADLRKKMVEEEQKNHLSGEICEMQTEELAGNSETLKEPETVGAQSI         1961 - 2024
//

Text Mined References (93)

PMID Year Title
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25074808 2014 Proteomic analysis of mammalian sperm cells identifies new components of the centrosome.
24913195 2014 Should myeloid and lymphoid neoplasms with PCM1-JAK2 and other rearrangements of JAK2 be recognized as specific entities?
24909162 2015 Targeted resequencing of the microRNAome and 3'UTRome reveals functional germline DNA variants with altered prevalence in epithelial ovarian cancer.
24816561 2014 Ccdc13 is a novel human centriolar satellite protein required for ciliogenesis and genome stability.
24648492 2014 Casein kinase 1? functions at the centrosome and Golgi to promote ciliogenesis.
24576429 2014 Four polymorphisms of the pericentriolar material 1 (PCM1) gene are not associated with schizophrenia in a Japanese population.
24550735 2014 The centriolar satellite protein AZI1 interacts with BBS4 and regulates ciliary trafficking of the BBSome.
More...