Property Summary

NCBI Gene PubMed Count 160
Grant Count 760
R01 Count 343
Funding $93,185,172.5
PubMed Score 762.63
PubTator Score 367.70

Knowledge Summary

Patent (36,268)

Expression

Synonym

Accession Q15139 A6NL64 B2RAF6
Symbols PKD
PKCM
PRKCM
PKC-MU

Gene

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (8)

AID Type Active / Inconclusive / Inactive Description
797 screening 109 / 0 / 196064 Fluorescence polarization assay for PKD inhibitors
1286 screening 14 / 4 / 68 Fluorescence polarization assay for PKD inhibitors - repeat of primary screen on hits identified from 140K library primary screen
1315 screening 4 / 0 / 82 Fluorescence polarization for PKD inhibitors - interference assay (140K library campaign)
1342 confirmatory 17 / 0 / 1 Fluorescence polarization assay for PKD inhibitiors-interference assay-57K HTS campaign
1408 confirmatory 11 / 0 / 19 Fluorescence polarization assay for PKD inhibitiors-IC50 determinations
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (121)

PMID Text
26584860 Knockdown of PKD1 did not affect NMDAR internalization but prevented the phosphorylation and inhibition of remaining surface NMDARs and NMDAR-mediated synaptic functions.
26518775 PRKD1 Mutation is not associated with Solid Tumors and Leukemias.
26338704 it is highly possible that PKD1 plays a critical role in signal transduction from the PKC pathway to the tyrosine kinase pathway
26253275 Studies indicate that the loss of protein kinase D PKD1 is thought to promote invasion and metastasis, while PKD2 and upregulated PKD3 to be positive regulators of proliferation.
25713110 Positional mapping of PRKD1, NRP1 and PRDM1 as novel candidate disease genes in truncus arteriosus
25445362 a positive relationship between L1 and pPKD1 in both cultured cerebellar neurons and human cerebellar tissue, suggesting that L1 functions in the modulation of PKD1 phosphorylation.
25240283 PRKD1 hotspot mutations encoding p.Glu710Asp in 72.9% of polymorphous low-grade adenocarcinomas, but not in other salivary gland tumors.
25149539 Results demonstrate a putative tumor-suppressor function of PKD1 in colon tumorigenesis via modulation of beta-catenin functions in cells.
25000413 Protein kinase D is increased and activated in lung epithelial cells and macrophages in idiopathic pulmonary fibrosis.
24942367 A novel and recurrent gene rearrangements in PRKD1-3 primarily in cribriform adenocarcinoma of minor salivary gland is described, suggesting a possible pathogenetic dichotomy from "classic" polymorphous low-grade adenocarcinoma.
More...

AA Sequence

MSAPPVLRPPSPLLPVAAAAAAAAAALVPGSGPGPAPFLAPVAAPVGGISFHLQIGLSREPVLLLQDSSG      1 - 70
DYSLAHVREMACSIVDQKFPECGFYGMYDKILLFRHDPTSENILQLVKAASDIQEGDLIEVVLSASATFE     71 - 140
DFQIRPHALFVHSYRAPAFCDHCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGVRRRRLSNVSLT    141 - 210
GVSTIRTSSAELSTSAPDEPLLQKSPSESFIGREKRSNSQSYIGRPIHLDKILMSKVKVPHTFVIHSYTR    211 - 280
PTVCQYCKKLLKGLFRQGLQCKDCRFNCHKRCAPKVPNNCLGEVTINGDLLSPGAESDVVMEEGSDDNDS    281 - 350
ERNSGLMDDMEEAMVQDAEMAMAECQNDSGEMQDPDPDHEDANRTISPSTSNNIPLMRVVQSVKHTKRKS    351 - 420
STVMKEGWMVHYTSKDTLRKRHYWRLDSKCITLFQNDTGSRYYKEIPLSEILSLEPVKTSALIPNGANPH    421 - 490
CFEITTANVVYYVGENVVNPSSPSPNNSVLTSGVGADVARMWEIAIQHALMPVIPKGSSVGTGTNLHRDI    491 - 560
SVSISVSNCQIQENVDISTVYQIFPDEVLGSGQFGIVYGGKHRKTGRDVAIKIIDKLRFPTKQESQLRNE    561 - 630
VAILQNLHHPGVVNLECMFETPERVFVVMEKLHGDMLEMILSSEKGRLPEHITKFLITQILVALRHLHFK    631 - 700
NIVHCDLKPENVLLASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRNKGYNRSLDMWSVG    701 - 770
VIIYVSLSGTFPFNEDEDIHDQIQNAAFMYPPNPWKEISHEAIDLINNLLQVKMRKRYSVDKTLSHPWLQ    771 - 840
DYQTWLDLRELECKIGERYITHESDDLRWEKYAGEQGLQYPTHLINPSASHSDTPETEETEMKALGERVS    841 - 910
IL                                                                        911 - 912
//

Text Mined References (173)

PMID Year Title
26584860 2015 Regulated internalization of NMDA receptors drives PKD1-mediated suppression of the activity of residual cell-surface NMDA receptors.
26518775 2016 Absence of PRKD1 Mutation, a Salivary Tumor-Specific Mutation, in Solid Tumors and Leukemias.
26338704 2015 Involvement of Protein Kinase D1 in Signal Transduction from the Protein Kinase C Pathway to the Tyrosine Kinase Pathway in Response to Gonadotropin-releasing Hormone.
26253275 2015 Functional and therapeutic significance of protein kinase D enzymes in invasive breast cancer.
25713110 2015 Positional mapping of PRKD1, NRP1 and PRDM1 as novel candidate disease genes in truncus arteriosus.
25445362 2015 L1 modulates PKD1 phosphorylation in cerebellar granule neurons.
25240283 2014 Hotspot activating PRKD1 somatic mutations in polymorphous low-grade adenocarcinomas of the salivary glands.
25149539 2014 Protein kinase D1 attenuates tumorigenesis in colon cancer by modulating ?-catenin/T cell factor activity.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
25000413 2014 Protein kinase D is increased and activated in lung epithelial cells and macrophages in idiopathic pulmonary fibrosis.
More...