Property Summary

NCBI Gene PubMed Count 30
PubMed Score 24.00
PubTator Score 26.42

Knowledge Summary

Patent (5,072)

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -2.227 0.000
glioblastoma -1.300 0.000
medulloblastoma, large-cell -1.200 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.011
ovarian cancer 2.500 0.000

Synonym

Gene

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 Collection (1)

Gene RIF (9)

PMID Text
26392360 Down-regulated CDK10 expression frequently occurs in breast cancers and correlates with disease progression and poor survival
26209438 Results found that CDK10 mRNA expression was up-regulated in advanced breast neoplasm and positively correlated with C1orf63, which was consistent with the relationship of protein expression between C1orf63 and CDK10.
24218572 CDK10/cyclin M is a protein kinase that controls ETS2 degradation and is deficient in STAR syndrome.
23740091 Data suggest that reactivation of CDK10 might be utilized as a novel epigenetic strategy for the treatment of nasopharyngeal carcinomas (NPC) patients.
22632162 FITC-labeled Tat 47-59 peptide downregulates gene expression of cyclin-dependent kinase 10 (CDK10) in U-937 macrophages
22326270 reduced Cdk10 expression is closely linked to hepatocellular carcinoma development and progression
22209942 CDK10 plays a crucial role in the growth and survivability of biliary tract cancer.
22158035 Data show that peptidyl-prolyl isomerase Pin1 silencing in SKBR-3 and MCF7 cells increased the cyclin-dependent kinase 10 (CDK10) expression.
19846932 CDK10 is not a target for aberrant DNA methylation in breast cancer.

AA Sequence

MAEPDLECEQIRLKCIRKEGFFTVPPEHRLGRCRSVKEFEKLNRIGEGTYGIVYRARDTQTDEIVALKKV      1 - 70
RMDKEKDGIPISSLREITLLLRLRHPNIVELKEVVVGNHLESIFLVMGYCEQDLASLLENMPTPFSEAQV     71 - 140
KCIVLQVLRGLQYLHRNFIIHRDLKVSNLLMTDKGCVKTADFGLARAYGVPVKPMTPKVVTLWYRAPELL    141 - 210
LGTTTQTTSIDMWAVGCILAELLAHRPLLPGTSEIHQIDLIVQLLGTPSENIWPGFSKLPLVGQYSLRKQ    211 - 280
PYNNLKHKFPWLSEAGLRLLHFLFMYDPKKRATAGDCLESSYFKEKPLPCEPELMPTFPHHRNKRAAPAT    281 - 350
SEGQSKRCKP                                                                351 - 360
//

Text Mined References (35)

PMID Year Title
26392360 2015 Decreased CDK10 expression correlates with lymph node metastasis and predicts poor outcome in breast cancer patients - a short report.
26209438 2015 Elevated C1orf63 expression is correlated with CDK10 and predicts better outcome for advanced breast cancers: a retrospective study.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
24980573 2014 Identification of a melanoma susceptibility locus and somatic mutation in TET2.
24218572 2013 CDK10/cyclin M is a protein kinase that controls ETS2 degradation and is deficient in STAR syndrome.
23740091 2013 Promoter hypermethylation contributes to the frequent suppression of the CDK10 gene in human nasopharyngeal carcinomas.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
22326270 2012 Clinical and biological significance of Cdk10 in hepatocellular carcinoma.
22209942 2012 CDK10 functions as a tumor suppressor gene and regulates survivability of biliary tract cancer cells.
22158035 2012 Proyl isomerase Pin1 facilitates ubiquitin-mediated degradation of cyclin-dependent kinase 10 to induce tamoxifen resistance in breast cancer cells.
More...