Property Summary

NCBI Gene PubMed Count 32
PubMed Score 27.67
PubTator Score 26.42

Knowledge Summary

Patent (5,072)

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Melanoma 711 0.0 3.0
Disease Target Count Z-score Confidence
Tick infestation 17 3.187 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
glioblastoma -1.300 2.9e-05
intraductal papillary-mucinous adenoma (... 1.100 1.1e-02
medulloblastoma, large-cell -1.200 1.3e-04
osteosarcoma -2.227 1.4e-05
ovarian cancer -1.400 4.5e-05

 GO Component (1)

Gene RIF (11)

AA Sequence

MAEPDLECEQIRLKCIRKEGFFTVPPEHRLGRCRSVKEFEKLNRIGEGTYGIVYRARDTQTDEIVALKKV      1 - 70
RMDKEKDGIPISSLREITLLLRLRHPNIVELKEVVVGNHLESIFLVMGYCEQDLASLLENMPTPFSEAQV     71 - 140
KCIVLQVLRGLQYLHRNFIIHRDLKVSNLLMTDKGCVKTADFGLARAYGVPVKPMTPKVVTLWYRAPELL    141 - 210
LGTTTQTTSIDMWAVGCILAELLAHRPLLPGTSEIHQIDLIVQLLGTPSENIWPGFSKLPLVGQYSLRKQ    211 - 280
PYNNLKHKFPWLSEAGLRLLHFLFMYDPKKRATAGDCLESSYFKEKPLPCEPELMPTFPHHRNKRAAPAT    281 - 350
SEGQSKRCKP                                                                351 - 360
//

Text Mined References (37)

PMID Year Title