Property Summary

NCBI Gene PubMed Count 77
PubMed Score 108.94
PubTator Score 52.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma 1.500 3.0e-02
atypical teratoid / rhabdoid tumor -1.300 5.2e-03
autosomal dominant Emery-Dreifuss muscul... 1.030 9.0e-04
Duchenne muscular dystrophy 1.046 1.0e-07
gastric carcinoma 1.100 1.5e-02
group 3 medulloblastoma -1.800 5.9e-04
juvenile dermatomyositis 1.191 2.7e-10
medulloblastoma, large-cell -1.500 3.8e-03
oligodendroglioma 1.800 3.1e-04
ovarian cancer 1.200 2.6e-05
pancreatic cancer 1.600 4.5e-03
primary pancreatic ductal adenocarcinoma 1.725 6.7e-03
psoriasis -1.500 2.6e-03
Rheumatoid arthritis -1.600 1.0e-02
tuberculosis and treatment for 6 months -1.200 1.7e-05
ulcerative colitis 1.400 3.2e-05

Synonym

Accession Q15121 B1AKZ3 O00511
Symbols PED
MAT1
HMAT1
MAT1H
PEA-15
HUMMAT1H
PED-PEA15
PED/PEA15

Gene

PDB

4IZ5   4IZA  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (57)

AA Sequence

MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEIS      1 - 70
RRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA               71 - 130
//

Text Mined References (85)

PMID Year Title