Property Summary

NCBI Gene PubMed Count 70
Grant Count 63
R01 Count 36
Funding $4,941,459.01
PubMed Score 101.03
PubTator Score 52.05

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q15121 B1AKZ3 O00511
Symbols PED
MAT1
HMAT1
MAT1H
PEA-15
HUMMAT1H

Gene

PDB

4IZ5   4IZA  

Gene RIF (53)

PMID Text
25957098 Latent HCMV infection of CD34 + cells protects cells from FAS-mediated apoptosis through the cellular IL-10/PEA-15 pathway.
25796184 Data show that phosphoprotein enriched in astrocytes of 15 kDa (PEA-15) influences dephosphorylation of epidermal growth factor receptor (EGFR) via extracellular signal-regulated kinases ERK1/2 sequestration in the cytoplasm.
25775393 High PED expression is associated with esophageal carcinoma.
25725291 The nuclear translocation of SApErk1/ 2 apart from PEA-15 as an important mechanism to reverse senescence phenotype.
25489735 PED/PEA-15 overexpression is sufficient to block hydrogen peroxide-induced apoptosis in Ins-1E cells through a PLD-1 mediated mechanism
25484138 Omi/HtrA2 overexpression promotes hepatocellular carcinoma cell apoptosis and the ped/pea-15 expression level causes this difference of the Omi/HtrA2 pro-apoptotic marker in the various hepatocellular carcinoma cell lines
25075716 Results suggest that neurochemical adaptations of brain FADD, as well as its interaction with PEA-15, could play a major role to counteract the known activation of the mitochondrial apoptotic pathway in major depression
24710276 Tumor suppressor PEA15 is a regulator of genome integrity and is an integral component of the DNA damage response pathway.
24657708 New therapeutic targets based around PEA-15 and its associated interactions are now being uncovered and could provide novel avenues for treatment strategies in multiple diseases.
24477641 Up-regulated chaperone-mediated autophagy activity characteristic of most types of cancer cell enhances oncogenesis by shifting the balance of PED function toward tumor promotion.
More...

AA Sequence

MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEIS      1 - 70
RRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA               71 - 130
//

Text Mined References (78)

PMID Year Title
25957098 2015 Latent infection of myeloid progenitors by human cytomegalovirus protects cells from FAS-mediated apoptosis through the cellular IL-10/PEA-15 pathway.
25796184 2015 PEA-15 facilitates EGFR dephosphorylation via ERK sequestration at increased ER-PM contacts in TNBC cells.
25775393 2015 Expression and significance of CDC25B, PED/PEA-15 in esophageal carcinoma.
25725291 2015 Downregulation of PEA-15 reverses G1 arrest, and nuclear and chromatin changes of senescence phenotype via pErk1/2 translocation to nuclei.
25489735 2014 PED/PEA-15 inhibits hydrogen peroxide-induced apoptosis in Ins-1E pancreatic beta-cells via PLD-1.
25484138 2015 Omi/HtrA2 pro-apoptotic marker differs in various hepatocellular carcinoma cell lines owing to ped/pea-15 expression level.
25075716 2014 FADD adaptor and PEA-15/ERK1/2 partners in major depression and schizophrenia postmortem brains: basal contents and effects of psychotropic treatments.
24710276 2014 PEA15 regulates the DNA damage-induced cell cycle checkpoint and oncogene-directed transformation.
24657708 2014 Phosphoprotein enriched in astrocytes (PEA)-15: a potential therapeutic target in multiple disease states.
24477641 2014 Phosphorylation-regulated degradation of the tumor-suppressor form of PED by chaperone-mediated autophagy in lung cancer cells.
More...