Property Summary

NCBI Gene PubMed Count 37
Grant Count 371
R01 Count 231
Funding $28,088,294.78
PubMed Score 8.66
PubTator Score 349.86

Knowledge Summary

Patent (42,947)

Expression

Synonym

Accession Q15118 B2R6T1 B7Z937 D3DPD8 E9PD65 Q308M4
Symbols

Gene

PANTHER Protein Class (3)

PDB

2Q8F   2Q8G   2Q8H  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (20)

PMID Text
26439504 High expression of PDK1 is associated with Colon Cancer.
26365179 PDK1 was specifically required for metabolic adaptation to nutrient limitation and hypoxia.
25976231 both PDK 1 and 2 isoforms are overexpressed in cutaneous melanoma compared to nevi, this expression being associated with the expression of the mTOR pathway effectors and independent of the BRAF mutational status
25301052 Lin28A and Lin28B enhance, whereas let-7 suppresses, aerobic glycolysis via targeting pyruvate dehydrogenase kinase 1, or PDK1.
25187374 Follow-up replication analyses in up to an additional 21,345 participants identified three new fasting plasma glucose loci reaching genome-wide significance in or near PDK1-RAPGEF4, KANK1, and IGF1R.
24788728 NOR1 expression causes apoptosis of tumor cells in hypoxia by altering the expression of PDK1 expression and mitochondrial Bax-Bcl2 balance thus suppress tumor cell adaptation to hypoxia
24123565 Accordingly, elevated levels of PDK1, PDK3, and PKM2 and reduced PK activity could be observed in iPSCs and human embryonic stem cells in the undifferentiated state
23811558 HIV-1 Tat induces phosphorylation of PDK1 in Tat-expressing cells and HIV-1-infected cells
23135628 High expression of pyruvate dehydrogenase kinase-1 is associated with gastric cancer.
22948140 post-mortem brain extracts from patients with Alzheimer disease exhibited a decrease in PDK1 expression compared with nondemented patients.
More...

AA Sequence

MRLARLLRGAALAGPGPGLRAAGFSRSFSSDSGSSPASERGVPGQVDFYARFSPSPLSMKQFLDFGSVNA      1 - 70
CEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTD     71 - 140
TVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGSP    141 - 210
SHRKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFEL    211 - 280
FKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAV    281 - 350
PLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDW    351 - 420
CVPSREPKDMTTFRSA                                                          421 - 436
//

Text Mined References (41)

PMID Year Title
26439504 2015 Clinical Implication of Serine Metabolism-Associated Enzymes in Colon Cancer.
26365179 2015 PDK1-Dependent Metabolic Reprogramming Dictates Metastatic Potential in Breast Cancer.
25976231 2015 Overexpression of pyruvate dehydrogenase kinase supports dichloroacetate as a candidate for cutaneous melanoma therapy.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25301052 2014 Lin28/let-7 axis regulates aerobic glycolysis and cancer progression via PDK1.
25187374 2015 Genome-wide association meta-analysis identifies novel variants associated with fasting plasma glucose in East Asians.
24788728 2014 Expression of oxidored nitro domain-containing protein 1(NOR1) impairs nasopharyngeal carcinoma cells adaptation to hypoxia and inhibits PDK1 expression.
24123565 2014 HIF1? modulates cell fate reprogramming through early glycolytic shift and upregulation of PDK1-3 and PKM2.
23135628 2013 Expression of pyruvate dehydrogenase kinase-1 in gastric cancer as a potential therapeutic target.
22948140 2012 Overexpression of pyruvate dehydrogenase kinase 1 and lactate dehydrogenase A in nerve cells confers resistance to amyloid ? and other toxins by decreasing mitochondrial respiration and reactive oxygen species production.
More...