Property Summary

Ligand Count 101
NCBI Gene PubMed Count 50
PubMed Score 10.29
PubTator Score 349.86

Knowledge Summary

Patent (42,947)

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma -1.800 1.8e-02
atypical teratoid / rhabdoid tumor 1.400 7.3e-04
Breast cancer 1.300 1.8e-04
cystic fibrosis and chronic rhinosinusit... 1.248 7.1e-04
glioblastoma 1.300 1.7e-03
group 3 medulloblastoma 1.100 5.0e-02
interstitial cystitis 1.700 8.6e-03
intraductal papillary-mucinous neoplasm ... 1.600 4.7e-03
lung adenocarcinoma 1.600 1.7e-12
lung cancer 1.100 1.2e-02
medulloblastoma, large-cell 2.200 8.8e-06
non-small cell lung cancer 1.618 5.9e-21
osteosarcoma 2.945 1.5e-03
ovarian cancer 2.200 1.5e-04
Pick disease 1.900 2.6e-04
posterior fossa group A ependymoma 1.300 2.7e-04
primary pancreatic ductal adenocarcinoma 1.517 1.1e-02
progressive supranuclear palsy 1.200 1.8e-02
psoriasis -1.100 2.1e-02

Protein-protein Interaction (5)

Gene RIF (33)

AA Sequence

MRLARLLRGAALAGPGPGLRAAGFSRSFSSDSGSSPASERGVPGQVDFYARFSPSPLSMKQFLDFGSVNA      1 - 70
CEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTD     71 - 140
TVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGSP    141 - 210
SHRKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFEL    211 - 280
FKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAV    281 - 350
PLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDW    351 - 420
CVPSREPKDMTTFRSA                                                          421 - 436
//

Text Mined References (54)

PMID Year Title