Property Summary

Ligand Count 2
NCBI Gene PubMed Count 553
PubMed Score 839.24
PubTator Score 920.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer -1.100 2.7e-04
psoriasis 2.200 7.4e-52

Gene RIF (570)

AA Sequence

MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRM      1 - 70
SPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRA     71 - 140
ELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGSLVLLVWVLAVICSRAARGTIGARRTGQPLK    141 - 210
EDPSAVPVFSVDYGELDFQWREKTPEPPVPCVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPE    211 - 280
DGHCSWPL                                                                  281 - 288
//

Text Mined References (555)

PMID Year Title