Property Summary

NCBI Gene PubMed Count 412
Grant Count 18
R01 Count 5
Funding $1,074,635.44
PubMed Score 523.79
PubTator Score 920.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer -1.100 0.000
psoriasis 2.200 0.000

Gene RIF (431)

PMID Text
27281199 genetic mechanism of tumor immune escape caused by structural variations commonly disrupting the 3' region of the PD-L1 gene
26927720 Data suggest signaling via CD279/PDCD1 and its ligand CD274/PD-L1 is effective chemotherapy target in non-small cell lung cancer; PD-L1 is best currently available immunohistochemistry biomarker for response to immune checkpoint inhibitors. [REVIEW]
26901407 expression of PD-1 identifies a diverse and patient-specific antitumor T cell response in peripheral blood, providing a novel noninvasive strategy to develop personalized therapies using neoantigen-reactive lymphocytes or TCRs to treat cancer
26782401 no such association was found in the CTLA4 or PDCD1 polymorphisms
26753722 Urinary PD-1 and FOXP3 mRNA were high in acute rejection of renal allograft.
26637667 Oncogenic activation of the AKT-mTOR pathway promotes immune escape by driving expression of PD-L1.
26631501 Immune checkpoint inhibitors, particularly those targeting PD-1 and PD-L1 are clinically active for the treatment of lung cancer and represent an exciting step forward in lung cancer therapy.
26608464 PD-1 regulates peripheral T-cell responses in both human and murine rheumatoid arthritis
26573233 Data suggest a reduction in the CD47 antigen/signal-regulatory protein alpha (SIRPalpha) pathway by programmed cell death protein 1 (PD-1) blockade, which regulates Myeloid-derived suppressor cells (MDSCs) and tumor associated macrophages (TAMs).
26567141 PD-1 acts in a distinct manner in innate immune cells compared with adaptive immune cells, prompting further investigations of the signaling pathways controlled by this central mediator of immune escape in cancer.
More...

AA Sequence

MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRM      1 - 70
SPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRA     71 - 140
ELRVTERRAEVPTAHPSPSPRPAGQFQTLVVGVVGGLLGSLVLLVWVLAVICSRAARGTIGARRTGQPLK    141 - 210
EDPSAVPVFSVDYGELDFQWREKTPEPPVPCVPEQTEYATIVFPSGMGTSSPARRGSADGPRSAQPLRPE    211 - 280
DGHCSWPL                                                                  281 - 288
//

Text Mined References (414)

PMID Year Title
27281199 2016 Aberrant PD-L1 expression through 3'-UTR disruption in multiple cancers.
26927720 2016 Non-Small Cell Lung Cancer, PD-L1, and the Pathologist.
26901407 2016 Prospective identification of neoantigen-specific lymphocytes in the peripheral blood of melanoma patients.
26782401 2015 Association between PDCD1, CTLA4, and MECP2 gene polymorphisms and systemic lupus erythematosus in the Chinese Northern Han.
26753722 2016 Validation of Urinary PD-1 and FOXP3 mRNA in a Cohort of Egyptian Renal Allograft Recipients.
26637667 2016 Control of PD-L1 Expression by Oncogenic Activation of the AKT-mTOR Pathway in Non-Small Cell Lung Cancer.
26631501 2016 Pembrolizumab for the treatment of thoracic malignancies: current landscape and future directions.
26608464 2015 Soluble PD-1 aggravates progression of collagen-induced arthritis through Th1 and Th17 pathways.
26573233 2015 PD-1 blockade attenuates immunosuppressive myeloid cells due to inhibition of CD47/SIRP? axis in HPV negative head and neck squamous cell carcinoma.
26567141 2016 PD-1 Blunts the Function of Ovarian Tumor-Infiltrating Dendritic Cells by Inactivating NF-?B.
More...