Property Summary

NCBI Gene PubMed Count 35
PubMed Score 56.58
PubTator Score 44.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Gene RIF (20)

AA Sequence

MLPAATASLLGPLLTACALLPFAQGQTPNYTRPVFLCGGDVKGESGYVASEGFPNLYPPNKECIWTITVP      1 - 70
EGQTVSLSFRVFDLELHPACRYDALEVFAGSGTSGQRLGRFCGTFRPAPLVAPGNQVTLRMTTDEGTGGR     71 - 140
GFLLWYSGRATSGTEHQFCGGRLEKAQGTLTTPNWPESDYPPGISCSWHIIAPPDQVIALTFEKFDLEPD    141 - 210
TYCRYDSVSVFNGAVSDDSRRLGKFCGDAVPGSISSEGNELLVQFVSDLSVTADGFSASYKTLPRGTAKE    211 - 280
GQGPGPKRGTEPKVKLPPKSQPPEKTEESPSAPDAPTCPKQCRRTGTLQSNFCASSLVVTATVKSMVREP    281 - 350
GEGLAVTVSLIGAYKTGGLDLPSPPTGASLKFYVPCKQCPPMKKGVSYLLMGQVEENRGPVLPPESFVVL    351 - 420
HRPNQDQILTNLSKRKCPSQPVRAAASQD                                             421 - 449
//

Text Mined References (37)

PMID Year Title