Property Summary

NCBI Gene PubMed Count 32
Grant Count 5
R01 Count 5
Funding $481,156.33
PubMed Score 50.92
PubTator Score 44.10

Knowledge Summary

Patent

No data available

Expression

Gene RIF (20)

PMID Text
25286301 Results suggest that PCPE-1 binding to syndecans and/or fibronectin may control collagen fibril assembly on the cell surface.
24117177 The analysis of the PCPE-1 interaction network based on Gene Ontology terms suggests that, besides its role in collagen deposition, PCPE-1 might be involved in tumour growth, neurodegenerative diseases and angiogenesis.
23815790 The results of this study suggested that nuclear entrapment of PCOLCE and its extracellular depletion represents a novel molecular mechanism in late-onset muscle fibrosis.
23550162 Procollagen C-proteinase enhancer grasps the stalk of the C-propeptide trimer to boost collagen precursor maturation.
21940633 Procollagen C-proteinase enhancer stimulates procollagen processing by binding to the C-propeptide region only.
21569766 data generated by our system, support our hypothesis that combined data on PCPE concentration and isoforms may be useful for the diagnosis and follow-up of bone diseases
20729553 procollagen C-proteinase enhancer-1 (PCPE-1) binds to heparin/heparan sulfate and has a role in interaction with cells
20207734 Role of the netrin-like domain of procollagen C-proteinase enhancer-1 in the control of metalloproteinase activity.
19801683 Data show that only those containing both PCPE1 CUB1 and CUB2 were capable of enhancing BMP-1 activity and binding to a mini-procollagen substrate with nanomolar affinity.
19361460 the sPCPE1 glycopattern appears to be associated with the physiological and pathological states of bone
More...

AA Sequence

MLPAATASLLGPLLTACALLPFAQGQTPNYTRPVFLCGGDVKGESGYVASEGFPNLYPPNKECIWTITVP      1 - 70
EGQTVSLSFRVFDLELHPACRYDALEVFAGSGTSGQRLGRFCGTFRPAPLVAPGNQVTLRMTTDEGTGGR     71 - 140
GFLLWYSGRATSGTEHQFCGGRLEKAQGTLTTPNWPESDYPPGISCSWHIIAPPDQVIALTFEKFDLEPD    141 - 210
TYCRYDSVSVFNGAVSDDSRRLGKFCGDAVPGSISSEGNELLVQFVSDLSVTADGFSASYKTLPRGTAKE    211 - 280
GQGPGPKRGTEPKVKLPPKSQPPEKTEESPSAPDAPTCPKQCRRTGTLQSNFCASSLVVTATVKSMVREP    281 - 350
GEGLAVTVSLIGAYKTGGLDLPSPPTGASLKFYVPCKQCPPMKKGVSYLLMGQVEENRGPVLPPESFVVL    351 - 420
HRPNQDQILTNLSKRKCPSQPVRAAASQD                                             421 - 449
//

Text Mined References (34)

PMID Year Title
25286301 2014 The NTR domain of procollagen C-proteinase enhancer-1 (PCPE-1) mediates PCPE-1 binding to syndecans-1, -2 and -4 as well as fibronectin.
24117177 2014 Extended interaction network of procollagen C-proteinase enhancer-1 in the extracellular matrix.
23815790 2013 Nuclear entrapment and extracellular depletion of PCOLCE is associated with muscle degeneration in oculopharyngeal muscular dystrophy.
23550162 2013 Procollagen C-proteinase enhancer grasps the stalk of the C-propeptide trimer to boost collagen precursor maturation.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22905912 2012 Resveratrol-induced changes of the human adipocyte secretion profile.
21940633 2011 Procollagen C-proteinase enhancer stimulates procollagen processing by binding to the C-propeptide region only.
21569766 2011 Quantification of human serum procollagen C-proteinase enhancer (hsPCPE) glycopattern.
21362503 2011 Protein profile of exosomes from trabecular meshwork cells.
More...