Property Summary

NCBI Gene PubMed Count 26
Grant Count 43
R01 Count 31
Funding $3,399,975.94
PubMed Score 148.39
PubTator Score 66.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
malignant mesothelioma -3.300 0.000
astrocytic glioma -1.800 0.027
ependymoma -3.000 0.000
oligodendroglioma -1.500 0.036
glioblastoma -2.100 0.000
osteosarcoma -1.133 0.001
group 4 medulloblastoma -2.700 0.000
atypical teratoid / rhabdoid tumor -2.400 0.000
medulloblastoma, large-cell -3.600 0.000
primitive neuroectodermal tumor -1.200 0.023
tuberculosis and treatment for 6 months 1.300 0.001
colon cancer -1.700 0.012
lung cancer -2.600 0.000
Breast cancer 2.500 0.030
lung adenocarcinoma -1.200 0.000
adult high grade glioma -2.200 0.000
pilocytic astrocytoma -2.000 0.000
aldosterone-producing adenoma -1.453 0.016
subependymal giant cell astrocytoma -2.851 0.006
Endometriosis -1.106 0.018
lung carcinoma 1.100 0.000
progressive supranuclear palsy -1.100 0.039
ovarian cancer -1.500 0.000
Gaucher disease type 3 -1.300 0.004
Down syndrome 1.200 0.001
head and neck cancer -1.200 0.049

Gene RIF (10)

PMID Text
26603167 susceptibility gene for dermatomyositis in Chinese patients with idiopathic inflammatory myopathies
23911386 PRIP interacts with the catalytic subunits of PP1 and PP2A and the interactions are regulated by phosphorylation. [review]
22128345 effect of DZP on PRIP-1 knockout mice was reduced
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20030815 In postmenopausal women, our results suggest that the PLCL1 rs7595412 polymorphism has no obvious effect on hip bone size and bone mineral density but may be associated with increased proportion of vertebral fracture and increased levels of osteocalcin
20030815 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18776929 PLCL1 is a novel gene associated with variation in hip bone size, which has a role in the pathogenesis of hip fractures
18776929 Genome-wide association study of gene-disease association. (HuGE Navigator)
16952428 PRIP-1 plays an important role in type A receptor signaling for gamma-aminobutyric acid in the brain

AA Sequence

MAEGAAGREDPAPPDAAGGEDDPRVGPDAAGDCVTAASGGRMRDRRSGVALPGAAGTPADSEAGLLEAAR      1 - 70
ATPRRSSIIKDPSNQKCGGRKKTVSFSSMPSEKKISSANDCISFMQAGCELKKVRPNSRIYNRFFTLDTD     71 - 140
LQALRWEPSKKDLEKAKLDISAIKEIRLGKNTETFRNNGLADQICEDCAFSILHGENYESLDLVANSADV    141 - 210
ANIWVSGLRYLVSRSKQPLDFMEGNQNTPRFMWLKTVFEAADVDGNGIMLEDTSVELIKQLNPTLKEAKI    211 - 280
RLKFKEIQKSKEKLTTRVTEEEFCEAFCELCTRPEVYFLLVQISKNKEYLDANDLMLFLEAEQGVTHITE    281 - 350
DICLDIIRRYELSEEGRQKGFLAIDGFTQYLLSSECDIFDPEQKKVAQDMTQPLSHYYINASHNTYLIED    351 - 420
QFRGPADINGYIRALKMGCRSVELDVSDGSDNEPILCNRNNMTTHVSFRSVIEVINKFAFVASEYPLILC    421 - 490
LGNHCSLPQQKVMAQQMKKVFGNKLYTEAPLPSESYLPSPEKLKRMIIVKGKKLPSDPDVLEGEVTDEDE    491 - 560
EAEMSRRMSVDYNGEQKQIRLCRELSDLVSICKSVQYRDFELSMKSQNYWEMCSFSETEASRIANEYPED    561 - 630
FVNYNKKFLSRIYPSAMRIDSSNLNPQDFWNCGCQIVAMNFQTPGPMMDLHTGWFLQNGGCGYVLRPSIM    631 - 700
RDEVSYFSANTKGILPGVSPLALHIKIISGQNFPKPKGACAKGDVIDPYVCIEIHGIPADCSEQRTKTVQ    701 - 770
QNSDNPIFDETFEFQVNLPELAMIRFVVLDDDYIGDEFIGQYTIPFECLQPGYRHVPLRSFVGDIMEHVT    771 - 840
LFVHIAITNRSGGGKAQKRSLSVRMGKKVREYTMLRNIGLKTIDDIFKIAVHPLREAIDMRENMQNAIVS    841 - 910
IKELCGLPPIASLKQCLLTLSSRLITSDNTPSVSLVMKDSFPYLEPLGAIPDVQKKMLTAYDLMIQESRF    911 - 980
LIEMADTVQEKIVQCQKAGMEFHEELHNLGAKEGLKGRKLNKATESFAWNITVLKGQGDLLKNAKNEAIE    981 - 1050
NMKQIQLACLSCGLSKAPSSSAEAKSKRSLEAIEEKESSEENGKL                            1051 - 1095
//

Text Mined References (36)

PMID Year Title
26603167 2016 Positive association of genetic variations in the phospholipase C-like 1 gene with dermatomyositis in Chinese Han.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23983088 2013 Genome-wide association study of dermatomyositis reveals genetic overlap with other autoimmune disorders.
23911386 2013 Phospholipase C-related but catalytically inactive protein, PRIP as a scaffolding protein for phospho-regulation.
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
23743675 2013 A meta-analysis of two genome-wide association studies to identify novel loci for maximum number of alcoholic drinks.
23722424 2013 GWAS of 126,559 individuals identifies genetic variants associated with educational attainment.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
More...