Property Summary

NCBI Gene PubMed Count 26
PubMed Score 148.39
PubTator Score 66.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count
ulcerative colitis 2087
Disease Target Count P-value
lung adenocarcinoma 2714 4.56811794311514E-16
ependymoma 2514 4.19792482917942E-14
pilocytic astrocytoma 3086 1.26459233078474E-9
ovarian cancer 8492 3.52368896116099E-8
lung carcinoma 2844 4.616718211556E-8
glioblastoma 5572 7.77192287141161E-8
malignant mesothelioma 3163 6.49515878378158E-7
adult high grade glioma 2148 1.7221528923185E-6
medulloblastoma, large-cell 6234 2.65443896037957E-6
group 4 medulloblastoma 1875 4.27381642721123E-6
lung cancer 4473 1.19134932509626E-5
atypical teratoid / rhabdoid tumor 4369 2.24863438223408E-4
osteosarcoma 7933 7.15671499516222E-4
tuberculosis and treatment for 6 months 686 0.00109956671726344
Down syndrome 548 0.00145898831594776
Gaucher disease type 3 76 0.00355025900581983
subependymal giant cell astrocytoma 2287 0.00619437473230955
colon cancer 1475 0.0122618275980236
aldosterone-producing adenoma 664 0.0157583781709915
Endometriosis 535 0.0183482782328515
primitive neuroectodermal tumor 3031 0.0225348829642526
astrocytic glioma 2241 0.0269957433371449
Breast cancer 3099 0.0301770928976917
oligodendroglioma 2849 0.0360269419427849
progressive supranuclear palsy 674 0.0393328585423551
head and neck cancer 270 0.0486181681031983
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
dermatomyositis 967 3.11 1.6
Urethral stricture 7 3.041 1.5

Expression

  Differential Expression (26)

Disease log2 FC p
malignant mesothelioma -3.300 0.000
astrocytic glioma -1.800 0.027
ependymoma -3.000 0.000
oligodendroglioma -1.500 0.036
glioblastoma -2.100 0.000
osteosarcoma -1.133 0.001
group 4 medulloblastoma -2.700 0.000
atypical teratoid / rhabdoid tumor -2.400 0.000
medulloblastoma, large-cell -3.600 0.000
primitive neuroectodermal tumor -1.200 0.023
tuberculosis and treatment for 6 months 1.300 0.001
colon cancer -1.700 0.012
lung cancer -2.600 0.000
Breast cancer 2.500 0.030
lung adenocarcinoma -1.200 0.000
adult high grade glioma -2.200 0.000
pilocytic astrocytoma -2.000 0.000
aldosterone-producing adenoma -1.453 0.016
subependymal giant cell astrocytoma -2.851 0.006
Endometriosis -1.106 0.018
lung carcinoma 1.100 0.000
progressive supranuclear palsy -1.100 0.039
ovarian cancer -1.500 0.000
Gaucher disease type 3 -1.300 0.004
Down syndrome 1.200 0.001
head and neck cancer -1.200 0.049

Synonym

Accession Q15111 Q3MJ90 Q53SD3 Q7Z3S3 PLC-L1
Symbols PLCE
PLCL
PRIP
PLDL1
PPP1R127

Gene

  Ortholog (11)

Gene RIF (10)

PMID Text
26603167 susceptibility gene for dermatomyositis in Chinese patients with idiopathic inflammatory myopathies
23911386 PRIP interacts with the catalytic subunits of PP1 and PP2A and the interactions are regulated by phosphorylation. [review]
22128345 effect of DZP on PRIP-1 knockout mice was reduced
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20030815 In postmenopausal women, our results suggest that the PLCL1 rs7595412 polymorphism has no obvious effect on hip bone size and bone mineral density but may be associated with increased proportion of vertebral fracture and increased levels of osteocalcin
20030815 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18776929 PLCL1 is a novel gene associated with variation in hip bone size, which has a role in the pathogenesis of hip fractures
18776929 Genome-wide association study of gene-disease association. (HuGE Navigator)
16952428 PRIP-1 plays an important role in type A receptor signaling for gamma-aminobutyric acid in the brain

AA Sequence

MAEGAAGREDPAPPDAAGGEDDPRVGPDAAGDCVTAASGGRMRDRRSGVALPGAAGTPADSEAGLLEAAR      1 - 70
ATPRRSSIIKDPSNQKCGGRKKTVSFSSMPSEKKISSANDCISFMQAGCELKKVRPNSRIYNRFFTLDTD     71 - 140
LQALRWEPSKKDLEKAKLDISAIKEIRLGKNTETFRNNGLADQICEDCAFSILHGENYESLDLVANSADV    141 - 210
ANIWVSGLRYLVSRSKQPLDFMEGNQNTPRFMWLKTVFEAADVDGNGIMLEDTSVELIKQLNPTLKEAKI    211 - 280
RLKFKEIQKSKEKLTTRVTEEEFCEAFCELCTRPEVYFLLVQISKNKEYLDANDLMLFLEAEQGVTHITE    281 - 350
DICLDIIRRYELSEEGRQKGFLAIDGFTQYLLSSECDIFDPEQKKVAQDMTQPLSHYYINASHNTYLIED    351 - 420
QFRGPADINGYIRALKMGCRSVELDVSDGSDNEPILCNRNNMTTHVSFRSVIEVINKFAFVASEYPLILC    421 - 490
LGNHCSLPQQKVMAQQMKKVFGNKLYTEAPLPSESYLPSPEKLKRMIIVKGKKLPSDPDVLEGEVTDEDE    491 - 560
EAEMSRRMSVDYNGEQKQIRLCRELSDLVSICKSVQYRDFELSMKSQNYWEMCSFSETEASRIANEYPED    561 - 630
FVNYNKKFLSRIYPSAMRIDSSNLNPQDFWNCGCQIVAMNFQTPGPMMDLHTGWFLQNGGCGYVLRPSIM    631 - 700
RDEVSYFSANTKGILPGVSPLALHIKIISGQNFPKPKGACAKGDVIDPYVCIEIHGIPADCSEQRTKTVQ    701 - 770
QNSDNPIFDETFEFQVNLPELAMIRFVVLDDDYIGDEFIGQYTIPFECLQPGYRHVPLRSFVGDIMEHVT    771 - 840
LFVHIAITNRSGGGKAQKRSLSVRMGKKVREYTMLRNIGLKTIDDIFKIAVHPLREAIDMRENMQNAIVS    841 - 910
IKELCGLPPIASLKQCLLTLSSRLITSDNTPSVSLVMKDSFPYLEPLGAIPDVQKKMLTAYDLMIQESRF    911 - 980
LIEMADTVQEKIVQCQKAGMEFHEELHNLGAKEGLKGRKLNKATESFAWNITVLKGQGDLLKNAKNEAIE    981 - 1050
NMKQIQLACLSCGLSKAPSSSAEAKSKRSLEAIEEKESSEENGKL                            1051 - 1095
//

Text Mined References (36)

PMID Year Title
26603167 2016 Positive association of genetic variations in the phospholipase C-like 1 gene with dermatomyositis in Chinese Han.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
23983088 2013 Genome-wide association study of dermatomyositis reveals genetic overlap with other autoimmune disorders.
23911386 2013 Phospholipase C-related but catalytically inactive protein, PRIP as a scaffolding protein for phospho-regulation.
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
23743675 2013 A meta-analysis of two genome-wide association studies to identify novel loci for maximum number of alcoholic drinks.
23722424 2013 GWAS of 126,559 individuals identifies genetic variants associated with educational attainment.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
More...