Property Summary

NCBI Gene PubMed Count 676
Grant Count 10
R01 Count 9
Funding $954,531.93
PubMed Score 173.71
PubTator Score 748.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 1.500 0.000
psoriasis -1.200 0.001
osteosarcoma -2.083 0.000
glioblastoma -1.100 0.000
non-small cell lung cancer -5.703 0.000
lung cancer -3.800 0.000
lung adenocarcinoma -5.400 0.000
adult high grade glioma -1.200 0.001
lung carcinoma -4.400 0.000

Gene RIF (637)

PMID Text
27026438 Multi-walled carbon nanotube induces injury or necrosis of lung epithelial cells and DNA damage via HMGB1/RAGE/TLR9 pathway.
27015414 RAGE and TGF-beta1 are both involved in fibrosis development in a complex cross-talk mechanism, while also acting on their own individual targets
26905625 Study indicates a role for S100A12, CML, and RAGE in peripheral arterial disease complications by activation of the RAGE system.
26880860 High and transient levels of IL-6 and methylglyoxal characterize the early immune response after trauma, whereas samples from later time points provide evidence for a secondary release of RAGE ligands. Our results provide evidence for a persisting activation of the RAGE axis while classical mediators like IL-6 disappear early.
26873694 These results indicate that RAGE may be a potential trigger in microvascular formation and proliferation in the development of endometrial cancer.
26828298 the G82S polymorphism in RAGE is associated with increased DRE risk and that the GS genotype of the G82S locus is a risk factor for drug-resistant epilepsy in the Chinese population.
26825459 AGER and its functions to stimulate O-GlcNAcylation are important during liver tumorigenesis, when high blood glucose levels are inadequately controlled.
26788516 In coronary artery disease patients RAGE may be involved in promoting epicardial adipose tissue adiposity and metabolic dysfunction, such as impaired insulin signaling.
26782577 There was no association between AGER gene polymorphisms and ulcerative colitis susceptibility in the Chinese Han population.
26782423 In conclusion, these data indicated that common polymorphisms in the AGER gene might increase the risks of breast (BC) and lung (LC) cancer .
More...

AA Sequence

MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGG      1 - 70
PWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNK     71 - 140
VGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSF    141 - 210
SPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPL    211 - 280
PPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALALGILGG    281 - 350
LGTAALLIGVILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP                    351 - 404
//

Text Mined References (678)

PMID Year Title
27026438 2016 Multi-walled carbon nanotube induces nitrative DNA damage in human lung epithelial cells via HMGB1-RAGE interaction and Toll-like receptor 9 activation.
27015414 2016 RAGE and TGF-?1 Cross-Talk Regulate Extracellular Matrix Turnover and Cytokine Synthesis in AGEs Exposed Fibroblast Cells.
26905625 2016 The Receptor for Advanced Glycation End Products (Rage) and Its Ligands in Plasma and Infrainguinal Bypass Vein.
26880860 2015 Role of the RAGE Axis during the Immune Response after Severe Trauma: A Prospective Pilot Study.
26873694 2016 Effects of receptor for advanced glycation endproducts on microvessel formation in endometrial cancer.
26828298 2016 Polymorphisms in the receptor for advanced glycation end products gene are associated with susceptibility to drug-resistant epilepsy.
26825459 2016 High Glucose Stimulates Tumorigenesis in Hepatocellular Carcinoma Cells Through AGER-Dependent O-GlcNAcylation of c-Jun.
26788516 2016 Expression of the Receptor for Advanced Glycation End Products in Epicardial Fat: Link with Tissue Thickness and Local Insulin Resistance in Coronary Artery Disease.
26782577 2015 Association between RAGE gene polymorphisms and ulcerative colitis susceptibility: a case-control study in a Chinese Han population.
26782423 2015 AGER genetic polymorphisms increase risks of breast and lung cancers.
More...