Property Summary

NCBI Gene PubMed Count 21
PubMed Score 4.85
PubTator Score 7.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.200 5.9e-05
Breast cancer 1.600 1.5e-22
breast carcinoma 1.700 2.7e-06
ductal carcinoma in situ 1.900 1.6e-04
group 3 medulloblastoma 2.100 4.2e-05
Hydrolethalus syndrome -1.285 6.2e-03
invasive ductal carcinoma 2.600 9.4e-05
lung adenocarcinoma 1.600 1.1e-08
medulloblastoma, large-cell 1.100 2.8e-04
non-small cell lung cancer 1.861 9.0e-29
primitive neuroectodermal tumor 1.500 1.3e-03
psoriasis 1.100 8.3e-04
tuberculosis 1.100 1.2e-06

Protein-protein Interaction (2)

Gene RIF (5)

AA Sequence

MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNF      1 - 70
GIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLP     71 - 140
RGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHS    141 - 210
LLLRLLAQDQGQGAPLLEPAP                                                     211 - 231
//

Text Mined References (27)

PMID Year Title