Property Summary

NCBI Gene PubMed Count 20
PubMed Score 4.93
PubTator Score 7.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
psoriasis 1.100 0.001
group 3 medulloblastoma 2.100 0.000
medulloblastoma, large-cell 1.100 0.000
primitive neuroectodermal tumor 1.500 0.001
tuberculosis 1.100 0.000
non-small cell lung cancer 1.861 0.000
Hydrolethalus syndrome -1.285 0.006
breast carcinoma 1.700 0.000
atypical teratoid/rhabdoid tumor 1.200 0.000
lung adenocarcinoma 1.600 0.000
Breast cancer 1.600 0.000
ductal carcinoma in situ 1.900 0.000
invasive ductal carcinoma 2.600 0.000

Synonym

Accession Q15102 Q53X88
Symbols PAFAHG

Gene

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
492972 screening 930 / 0 / 334531 Fluorescence polarization-based primary biochemical high throughput screening assay to identify inhibitors of human platelet-activating factor acetylhydrolase 1B, catalytic subunit 3 (PAFAH1B3)
492979 summary 0 / 0 / 0 Summary of the probe development efforts to identify inhibitors of human platelet-activating factor acetylhydrolase 1B, catalytic subunit 3 (PAFAH1B3)
493032 screening 118 / 0 / 274 Fluorescence polarization-based biochemical high throughput confirmation assay for inhibitors of human platelet-activating factor acetylhydrolase 1B, catalytic subunit 3 (PAFAH1B3)

Gene RIF (5)

PMID Text
25945974 PAFAH1B2 and 1B3 are important in maintaining cancer pathogenicity across a wide spectrum of cancer types.
24954006 PAFAH1B3 as a critical metabolic node in breast cancer
22461910 PAFAH1B3 has been found to be differentially methylated in head and neck squamous cell carcinoma.
21844189 intracellular type I PAF acetylhydrolase (PAFAH1B2 and PAFAH1B3) is the major aspirin hydrolase of human blood
19622634 These results indicate an antagonistic effect of alpha1, alpha2 and Ndel1 for Lis1 binding, probably to modulate dynein functions in vivo.

AA Sequence

MSGEENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNF      1 - 70
GIGGDGTQHVLWRLENGELEHIRPKIVVVWVGTNNHGHTAEQVTGGIKAIVQLVNERQPQARVVVLGLLP     71 - 140
RGQHPNPLREKNRQVNELVRAALAGHPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHS    141 - 210
LLLRLLAQDQGQGAPLLEPAP                                                     211 - 231
//

Text Mined References (26)

PMID Year Title
25945974 2015 Activity-Based Protein Profiling of Oncogene-Driven Changes in Metabolism Reveals Broad Dysregulation of PAFAH1B2 and 1B3 in Cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24954006 2014 Metabolic profiling reveals PAFAH1B3 as a critical driver of breast cancer pathogenicity.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22461910 2012 FOXM1 induces a global methylation signature that mimics the cancer epigenome in head and neck squamous cell carcinoma.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21844189 2011 Intracellular erythrocyte platelet-activating factor acetylhydrolase I inactivates aspirin in blood.
More...