Property Summary

NCBI Gene PubMed Count 42
PubMed Score 35.24
PubTator Score 22.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
active Crohn's disease 1.095 6.4e-03
Astrocytoma, Pilocytic 1.200 7.4e-07
atypical teratoid / rhabdoid tumor 1.100 1.5e-04
dermatomyositis 2.100 9.2e-04
ependymoma 1.200 8.3e-11
glioblastoma 1.200 8.3e-07
group 3 medulloblastoma 1.200 5.7e-03
inflammatory breast cancer 1.100 2.3e-02
intraductal papillary-mucinous neoplasm ... -1.200 4.6e-02
invasive ductal carcinoma 1.100 2.7e-02
juvenile dermatomyositis 1.045 1.6e-08
lung adenocarcinoma 1.308 6.8e-10
lung cancer 1.600 9.6e-04
medulloblastoma, large-cell 1.200 3.0e-04
Multiple myeloma 1.017 1.9e-02
non-small cell lung cancer 1.325 2.1e-25
ovarian cancer 2.300 2.7e-04
pancreatic ductal adenocarcinoma liver m... -2.055 1.4e-02
pediatric high grade glioma 1.300 8.3e-06

Protein-protein Interaction (8)

Gene RIF (26)

AA Sequence

MALLVLGLVSCTFFLAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAAT      1 - 70
ALKDVVKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLG     71 - 140
GRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQ    141 - 210
TKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLE    211 - 280
IINEDIAKRTCEEHQLCVVAVLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALG    281 - 350
IGGFGYPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPTIVEREPWDGRDGELP    351 - 420
VEDDIDLSDVELDDLGKDEL                                                      421 - 440
//

Text Mined References (57)

PMID Year Title