Property Summary

NCBI Gene PubMed Count 74
Grant Count 58
R01 Count 34
Funding $2,976,242.84
PubMed Score 247.46
PubTator Score 127.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
cutaneous lupus erythematosus 1.900 0.001
osteosarcoma -4.357 0.000
glioblastoma 1.700 0.004
periodontitis 1.400 0.000
adrenocortical carcinoma -1.108 0.007
tuberculosis 1.100 0.001
non-small cell lung cancer -1.614 0.000
lung cancer -1.600 0.000
active Crohn's disease 1.714 0.001
interstitial cystitis 1.600 0.002
adult high grade glioma 1.200 0.002
pilocytic astrocytoma 1.100 0.000
invasive ductal carcinoma 1.001 0.001
lung carcinoma -2.200 0.000
acute myeloid leukemia 1.200 0.024
ulcerative colitis 1.800 0.000

Synonym

Accession Q15080 A8K4F9 O60808 Q86U56 Q9BU98 Q9NP45 NCF-4
Symbols NCF
CGD3
P40PHOX
SH3PXD4

Gene

PDB

1W70   1H6H   1OEY   1W6X   1Z9Q   2DYB  

 GWAS Trait (1)

Gene RIF (39)

PMID Text
26289093 NCF4 polymorphism was associated with Crohn's disease, but not ulcerative colitis in Caucasian--{REVIEW}
24378533 NCF4 may induce ex- pression of NADPH oxidase enzymes, such as p67phox, p47phox, p22phox and NOX2, which lead to increased ROS levels.
23982929 Germline variation in NCF4, an innate immunity gene, is associated with an increased risk of colorectal cancer.
23576480 The contribution of the functionally relevant NADPH polymorphisms rs1883112 and rs4673 to anthracycline-related heart lesions provides a plausible explanation for their modulation of cardiotoxicity.
22984083 Constitutive and inducible intracellular production of reactive oxygen species (ROS) is higher in B cells expressing functional p40phox, supporting a direct role for p40phox in regulating B cell intracellular ROS generation.
22158027 Younger age at diagnosis, complicated disease behavior, and ileal disease location are risk factors for perianal CD. First report of an association of the NCF4 gene with perianal disease.
21956105 cooperation of p40(phox) with p47(phox) for Nox2-based NADPH oxidase activation during Fcgamma receptor (FcgammaR)-mediated phagocytosis
21518975 Results demonstrate that PBEF can prime for PMN respiratory burst activity by promoting p40 and p47 translocation to the membrane.
21472827 Genome-wide association studies-reported associations between the NELL1, NCF4, and FAM92B genes and susceptibility to Crohn's disease could not be replicated in Canadian children and young adults.
21122541 no association between SNP rs4821544 and the presence of granulomas in Crohn's disease
More...

AA Sequence

MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLE      1 - 70
ERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDS     71 - 140
EQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFDFTGNSKLELNFKAGDVIFLLSRINKDWLEG    141 - 210
TVRGATGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKDIAVEEDLSSTPLLKDLLELTRREFQR    211 - 280
EDIALNYRDAEGDLVRLLSDEDVALMVRQARGLPSQKRLFPWKLHITQKDNYRVYNTMP               281 - 339
//

Text Mined References (75)

PMID Year Title
26289093 2015 Association between NCF4 rs4821544T/C polymorphism and inflammatory bowel disease risk in Caucasian: a meta-analysis.
24378533 2014 Activation of NADPH oxidase subunit NCF4 induces ROS-mediated EMT signaling in HeLa cells.
23982929 2014 Germline variation in NCF4, an innate immunity gene, is associated with an increased risk of colorectal cancer.
23576480 2013 Association of anthracycline-related cardiac histological lesions with NADPH oxidase functional polymorphisms.
22984083 2012 Cutting edge: NADPH oxidase modulates MHC class II antigen presentation by B cells.
22197932 2011 Meta-analysis of genome-wide association studies identifies three new risk loci for atopic dermatitis.
22158027 2012 Clinical and genetic risk factors for perianal Crohn's disease in a population-based cohort.
21956105 2011 Cooperation of p40(phox) with p47(phox) for Nox2-based NADPH oxidase activation during Fc? receptor (Fc?R)-mediated phagocytosis: mechanism for acquisition of p40(phox) phosphatidylinositol 3-phosphate (PI(3)P) binding.
21518975 2011 Pre-B cell colony-enhancing factor (PBEF/Nampt/visfatin) primes neutrophils for augmented respiratory burst activity through partial assembly of the NADPH oxidase.
21472827 2012 NELL1, NCF4, and FAM92B genes are not major susceptibility genes for Crohn's disease in Canadian children and young adults.
More...