Property Summary

Ligand Count 3
NCBI Gene PubMed Count 84
PubMed Score 52.41
PubTator Score 206.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -2.900 3.2e-04
astrocytic glioma -2.300 9.7e-03
Astrocytoma, Pilocytic -2.700 5.5e-08
Atopic dermatitis 1.300 2.7e-03
atypical teratoid / rhabdoid tumor -3.100 3.6e-04
colon cancer -1.200 2.7e-02
cutaneous lupus erythematosus 1.600 3.6e-03
ependymoma -3.800 2.9e-02
esophageal adenocarcinoma -1.300 2.1e-02
glioblastoma -2.000 2.4e-05
group 4 medulloblastoma 2.200 2.6e-04
lung cancer 1.400 4.3e-02
non primary Sjogren syndrome sicca -1.300 1.9e-02
non-small cell lung cancer 1.426 3.8e-13
oligodendroglioma -1.300 3.1e-02
osteosarcoma -2.424 7.5e-05
pituitary cancer 1.100 3.0e-02
psoriasis 1.300 3.1e-06
sarcoidosis -1.100 3.8e-02
tuberculosis -1.700 9.3e-04

Protein-protein Interaction (11)

Gene RIF (53)

AA Sequence

MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQP      1 - 70
NSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPK     71 - 140
RVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRD    141 - 210
VISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPH    211 - 280
YFTQVFSDLKNESGQEDKKRLLLGLDR                                               281 - 307
//

Text Mined References (91)

PMID Year Title