Property Summary

NCBI Gene PubMed Count 81
Grant Count 170
R01 Count 94
Funding $20,552,932.51
PubMed Score 49.60
PubTator Score 206.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
astrocytoma -3.000 0.004
posterior fossa group A ependymoma -3.900 0.000
oligodendroglioma -1.400 0.000
esophageal adenocarcinoma -1.300 0.021
psoriasis 2.300 0.000
cutaneous lupus erythematosus 1.600 0.004
glioblastoma -3.000 0.004
osteosarcoma -2.424 0.000
atypical teratoid / rhabdoid tumor -3.100 0.000
Atopic dermatitis 1.300 0.003
tuberculosis -1.700 0.001
non-small cell lung cancer 1.426 0.000
colon cancer -1.200 0.027
lung cancer 3.700 0.000
adult high grade glioma -2.900 0.000
group 4 medulloblastoma 2.200 0.000
pilocytic astrocytoma -2.700 0.000
non primary Sjogren syndrome sicca -1.300 0.019
pituitary cancer 1.100 0.030
sarcoidosis -1.100 0.038

Synonym

Accession Q15078 E1P664 Q5U0G3 CDK5 activator 1
Symbols p23
p25
p35
CDK5R
NCK5A
CDK5P35
p35nck5a

Gene

PDB

1H4L   1UNG   1UNH   1UNL   3O0G  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases

Gene RIF (53)

PMID Text
25391294 Under cell-free in vitro conditions, p35 is covalently modified by SUMO1. SUMO2 is conjugated to p35 in cells. The 2 major SUMO acceptor lysines in p35 are K246 and K290. Different degrees of oxidative stress resulted in differential p35 sumoylation.
24802945 Cdk5/p35 is required for motor learning and involved in long-term synaptic plasticity.
24725413 These results reveal a physiological role of p25 production in synaptic plasticity and memory and provide new insights into the function of p25 in Abeta-associated neurotoxicity and Alzheimer's disease-like pathology.
24550687 Expression of p35 is upregulated in human pituitary adenomas.
24085300 Structural basis for the different stability and activity between the Cdk5 complexes with p35 and p39 activators.
23151508 p10, the N-terminal domain of p35, protects against CDK5/p25-induced neurotoxicity.
22964075 Reduced p35 basal content and down--regulation of CDK5/p35/p25 by antipsychotics are demonstrated in postmortem prefrontal cortex of schizophrenic subjects.
21772061 This study suggested that reduced p35 expression in schizophrenia has an impact on synaptic protein expression and cognition and that these deficits can be rescued, at least in part, by the inhibition of histone deacetylase 1.
21625387 findings indicate that miR-103 and miR-107 regulate CDK5R1 expression, allowing us to hypothesize that a miRNA-mediated mechanism may influence CDK5 activity and the associated molecular pathways
21544067 The decrease in membrane-associated p35 in socially isolated transgenic mice reduces associated levels of p35, alpha-CaMKII, and GluR1 and leads to endocytosis of AMPA receptors.
More...

AA Sequence

MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSAKKKNSKKVQP      1 - 70
NSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPK     71 - 140
RVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRD    141 - 210
VISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPH    211 - 280
YFTQVFSDLKNESGQEDKKRLLLGLDR                                               281 - 307
//

Text Mined References (88)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25391294 2015 Sumoylation of p35 modulates p35/cyclin-dependent kinase (Cdk) 5 complex activity.
24802945 2014 Cdk5/p35 is required for motor coordination and cerebellar plasticity.
24725413 2014 Activity-dependent p25 generation regulates synaptic plasticity and A?-induced cognitive impairment.
24550687 2014 CDK5 and its activator P35 in normal pituitary and in pituitary adenomas: relationship to VEGF expression.
24235147 2013 Cyclin-dependent kinase 5 (Cdk5) regulates the function of CLOCK protein by direct phosphorylation.
24085300 2013 Structural basis for the different stability and activity between the Cdk5 complexes with p35 and p39 activators.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23151508 2012 p10, the N-terminal domain of p35, protects against CDK5/p25-induced neurotoxicity.
22964075 2013 Cyclin-dependent kinase-5 and p35/p25 activators in schizophrenia and major depression prefrontal cortex: basal contents and effects of psychotropic medications.
More...