Property Summary

Ligand Count 31
NCBI Gene PubMed Count 45
PubMed Score 102.57
PubTator Score 161.58

Knowledge Summary

Patent (3,032)

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Hypertrophic cardiomyopathy 20 12 3.235 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
cutaneous lupus erythematosus 1.600 1.7e-04
inflammatory breast cancer 1.500 3.2e-03
interstitial cystitis 1.100 2.5e-04
lung adenocarcinoma 2.700 2.6e-09
tuberculosis -1.200 2.7e-04

Gene RIF (32)

AA Sequence

MEWDNGTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAGLPLNICVITQICTSRRALTRTAVYTLNLAL      1 - 70
ADLLYACSLPLLIYNYAQGDHWPFGDFACRLVRFLFYANLHGSILFLTCISFQRYLGICHPLAPWHKRGG     71 - 140
RRAAWLVCVAVWLAVTTQCLPTAIFAATGIQRNRTVCYDLSPPALATHYMPYGMALTVIGFLLPFAALLA    141 - 210
CYCLLACRLCRQDGPAEPVAQERRGKAARMAVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCTVLEAFA    211 - 280
AAYKGTRPFASANSVLDPILFYFTQKKFRRRPHELLQKLTAKWQRQGR                          281 - 328
//

Text Mined References (45)

PMID Year Title