Property Summary

NCBI Gene PubMed Count 42
Grant Count 31
R01 Count 16
Funding $2,209,048.94
PubMed Score 94.56
PubTator Score 161.58

Knowledge Summary

Patent (3,032)

Expression

  Differential Expression (5)

Gene RIF (29)

PMID Text
25816245 data demonstrate that HNP-1 induces IL-8 production not only through P2Y6, but also through additional P2 receptors via an ERK1/2-dependent mechanism in intestinal epithelial cells.
25445541 high millimolar concentrations of ATP increased IL-8 and MCP-1 release by the glioma cells stimulated with suboptimal LPS concentration which were blocked by P2X7 and P2Y6 antagonists
25243587 nucleotides released during the airway inflammatory processes will activate P2Y6 receptors, which will lead to further release of inflammatory cytokines.
23723068 Data indicate that after P2Y6 receptor stimulation both phospholipase D (PLD) and DGKzeta enzymes are responsible for producing phosphatidic acid (PA).
22558990 no obvious correlation was found between the expression of P2Y6 and breast cancer cell proliferation
22249129 Results indicate involvement of P2Y purinoceptors P2Y(1) and P2Y(6) receptors in ADP- and UDP-stimulated proliferation.
22102722 P2Y(6) receptor signaling pathway may be a potential therapeutic target for MSU-associated inflammatory diseases, such as tophaceous gout.
21898410 Report role of ecto-NTPDases on UDP-sensitive P2Y(6) receptor activation during osteogenic differentiation of primary bone marrow stromal cells from postmenopausal women.
21724990 P2Y6 receptor transgene is an important endogenous inhibitor of T cell function in mice with allergic pulmonary inflammation
21388279 activation of P2Y6 receptor mediates the UVB-radiation-induced activation of p38 MAPK and expression of COX-2
More...

AA Sequence

MEWDNGTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAGLPLNICVITQICTSRRALTRTAVYTLNLAL      1 - 70
ADLLYACSLPLLIYNYAQGDHWPFGDFACRLVRFLFYANLHGSILFLTCISFQRYLGICHPLAPWHKRGG     71 - 140
RRAAWLVCVAVWLAVTTQCLPTAIFAATGIQRNRTVCYDLSPPALATHYMPYGMALTVIGFLLPFAALLA    141 - 210
CYCLLACRLCRQDGPAEPVAQERRGKAARMAVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCTVLEAFA    211 - 280
AAYKGTRPFASANSVLDPILFYFTQKKFRRRPHELLQKLTAKWQRQGR                          281 - 328
//

Text Mined References (42)

PMID Year Title
25816245 2015 Human neutrophil peptides induce interleukin-8 in intestinal epithelial cells through the P2 receptor and ERK1/2 signaling pathways.
25445541 2015 Nucleotide receptors control IL-8/CXCL8 and MCP-1/CCL2 secretions as well as proliferation in human glioma cells.
25416956 2014 A proteome-scale map of the human interactome network.
25243587 2014 P2Y6 receptor-mediated proinflammatory signaling in human bronchial epithelia.
23723068 2013 Regulation of phospholipase D activity and phosphatidic acid production after purinergic (P2Y6) receptor stimulation.
22558990 2012 [Construction of P2Y6 constitutive knock down breast cancer cell line and evaluation of its proliferation].
22249129 2012 P2Y receptors regulate proliferation of human pancreatic duct epithelial cells.
22102722 2012 P2Y6 receptor signaling pathway mediates inflammatory responses induced by monosodium urate crystals.
21898410 2012 Role of ecto-NTPDases on UDP-sensitive P2Y(6) receptor activation during osteogenic differentiation of primary bone marrow stromal cells from postmenopausal women.
21724990 2011 The purinergic G protein-coupled receptor 6 inhibits effector T cell activation in allergic pulmonary inflammation.
More...