Property Summary

NCBI Gene PubMed Count 55
PubMed Score 155.88
PubTator Score 150.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
periodontitis 269 2.50603510513068E-29
posterior fossa group A ependymoma 1511 2.38383964893166E-8
juvenile dermatomyositis 1189 1.34545403456807E-6
psoriasis 6685 4.30689703595678E-6
pediatric high grade glioma 2712 8.73421038738676E-6
Amyotrophic Lateral Sclerosis 432 3.84821684651249E-5
glioblastoma 5572 9.68744995704233E-5
ovarian cancer 8492 5.63114923884383E-4
medulloblastoma, large-cell 6234 8.75938515490034E-4
osteosarcoma 7933 0.00122779363154449
Gaucher disease type 3 76 0.00177183303310167
invasive ductal carcinoma 2950 0.00323297971447481
head and neck cancer and chronic obstructive pulmonary disease 237 0.00527475224851799
acute quadriplegic myopathy 1157 0.00587494648558526
head and neck cancer 270 0.0354672959429524
lung cancer 4473 0.0358178333901594
urothelial carcinoma 318 0.037251577471503
hereditary spastic paraplegia 313 0.0499120193672558
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Liver disease 219 0.0 1.0

Expression

  Differential Expression (18)

Synonym

Accession Q15075 Q14221
Symbols MST105
ZFYVE2
MSTP105

Gene

PDB

1HYI   1HYJ   1JOC   3MJH  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid

Gene RIF (23)

PMID Text
26993163 EEA1 mobility on endosomes is decreased upon stimulation of EGF receptor endocytosis in HeLa cells
25998683 Under the regulation of Rab5, the fused vesicles are targeted to early endosomes and thus deliver the internalized TbetaRI to the caveolin-1 and EEA1 double-positive early endosomes (caveolin-1-positive early endosomes).
25711083 In serum-deprivated HeLa cells with low endocytic activity there two types of EEA1-vesicles: the first one carries the both EEA1 and Rab5 at high levels; the second consists of weakly decorated EEA1-vesicles that can be both Rab5-positive and -negative.
24644286 Data indicate that early endosome antigen 1 (EEA1) is important for the small GTPase Rab31-mediated enhancement of ligand-bound EGF receptor (EGFR) endocytic trafficking.
24491918 nuclear uptake of Abeta involves the dynamin-dependent EEA1 and TGF-beta/Smad signaling pathways.
24086611 Expression of HIV-1 Vpu induces co-localization of tetherin with early endosome protein EEA-1 or late endosome protein LAMP-1
23874603 Expression of HIV-1 Vpu induces co-localization of tetherin with early endosome protein EEA-1 or late endosome protein LAMP-1
23729440 Expression of HIV-1 Vpu induces co-localization of tetherin with early endosome protein EEA-1 or late endosome protein LAMP-1
23499280 We therefore propose that the N1072K variant of the EEA1 gene is a candidate mutation for susceptibility to diabetes in the Japanese population.
22915584 NMR analyses of the interaction between the FYVE domain of early endosome antigen 1 (EEA1) and phosphoinositide embedded in a lipid bilayer.
More...

AA Sequence

MLRRILQRTPGRVGSQGSDLDSSATPINTVDVNNESSSEGFICPQCMKSLGSADELFKHYEAVHDAGNDS      1 - 70
GHGGESNLALKRDDVTLLRQEVQDLQASLKEEKWYSEELKKELEKYQGLQQQEAKPDGLVTDSSAELQSL     71 - 140
EQQLEEAQTENFNIKQMKDLFEQKAAQLATEIADIKSKYDEERSLREAAEQKVTRLTEELNKEATVIQDL    141 - 210
KTELLQRPGIEDVAVLKKELVQVQTLMDNMTLERERESEKLKDECKKLQSQYASSEATISQLRSELAKGP    211 - 280
QEVAVYVQELQKLKSSVNELTQKNQTLTENLLKKEQDYTKLEEKHNEESVSKKNIQATLHQKDLDCQQLQ    281 - 350
SRLSASETSLHRIHVELSEKGEATQKLKEELSEVETKYQHLKAEFKQLQQQREEKEQHGLQLQSEINQLH    351 - 420
SKLLETERQLGEAHGRLKEQRQLSSEKLMDKEQQVADLQLKLSRLEEQLKEKVTNSTELQHQLDKTKQQH    421 - 490
QEQQALQQSTTAKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKENISLLEKEREDLYAKIQAGEGET    491 - 560
AVLNQLQEKNHTLQEQVTQLTEKLKNQSESHKQAQENLHDQVQEQKAHLRAAQDRVLSLETSVNELNSQL    561 - 630
NESKEKVSQLDIQIKAKTELLLSAEAAKTAQRADLQNHLDTAQNALQDKQQELNKITTQLDQVTAKLQDK    631 - 700
QEHCSQLESHLKEYKEKYLSLEQKTEELEGQIKKLEADSLEVKASKEQALQDLQQQRQLNTDLELRATEL    701 - 770
SKQLEMEKEIVSSTRLDLQKKSEALESIKQKLTKQEEEKKILKQDFETLSQETKIQHEELNNRIQTTVTE    771 - 840
LQKVKMEKEALMTELSTVKDKLSKVSDSLKNSKSEFEKENQKGKAAILDLEKTCKELKHQLQVQMENTLK    841 - 910
EQKELKKSLEKEKEASHQLKLELNSMQEQLIQAQNTLKQNEKEEQQLQGNINELKQSSEQKKKQIEALQG    911 - 980
ELKIAVLQKTELENKLQQQLTQAAQELAAEKEKISVLQNNYEKSQETFKQLQSDFYGRESELLATRQDLK    981 - 1050
SVEEKLSLAQEDLISNRNQIGNQNKLIQELKTAKATLEQDSAKKEQQLQERCKALQDIQKEKSLKEKELV   1051 - 1120
NEKSKLAEIEEIKCRQEKEITKLNEELKSHKLESIKEITNLKDAKQLLIQQKLELQGKADSLKAAVEQEK   1121 - 1190
RNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEAKLTMQITALNENLGTVKKEWQSS   1191 - 1260
QRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQEL   1261 - 1330
GRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVR   1331 - 1400
VCDACFNDLQG                                                              1401 - 1411
//

Text Mined References (62)

PMID Year Title
26993163 2016 Mobility of tethering factor EEA1 on endosomes is decreased upon stimulation of EGF receptor endocytosis in HeLa cells.
25998683 2015 Internalization of the TGF-? type I receptor into caveolin-1 and EEA1 double-positive early endosomes.
25711083 2014 [Analysis of vesicle subpopulations carrying early endosomal autoantigen EEA1].
25327288 2014 Selective VPS34 inhibitor blocks autophagy and uncovers a role for NCOA4 in ferritin degradation and iron homeostasis in vivo.
24644286 2014 Engagement of the small GTPase Rab31 protein and its effector, early endosome antigen 1, is important for trafficking of the ligand-bound epidermal growth factor receptor from the early to the late endosome.
24491918 2014 HIV-1 stimulates nuclear entry of amyloid beta via dynamin dependent EEA1 and TGF-?/Smad signaling.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24029230 2013 Haploinsufficiency of SAMD9L, an endosome fusion facilitator, causes myeloid malignancies in mice mimicking human diseases with monosomy 7.
23499280 2013 Exome sequencing identifies a new candidate mutation for susceptibility to diabetes in a family with highly aggregated type 2 diabetes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...