Property Summary

NCBI Gene PubMed Count 56
PubMed Score 167.59
PubTator Score 150.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
acute quadriplegic myopathy 1.002 5.9e-03
Amyotrophic lateral sclerosis 1.184 3.8e-05
ependymoma 1.200 9.2e-07
Gaucher disease type 1 -1.200 1.1e-02
glioblastoma 1.500 9.7e-05
head and neck cancer -1.200 3.5e-02
head and neck cancer and chronic obstruc... -1.100 5.3e-03
hereditary spastic paraplegia -1.119 5.0e-02
invasive ductal carcinoma -1.200 3.2e-03
juvenile dermatomyositis 1.156 1.3e-06
lung cancer -1.300 3.6e-02
medulloblastoma, large-cell -1.300 8.8e-04
osteosarcoma -1.658 7.6e-04
ovarian cancer -1.200 5.6e-04
pediatric high grade glioma 1.200 8.7e-06
periodontitis -1.300 2.5e-29
psoriasis -3.500 4.3e-06
urothelial carcinoma -1.100 3.7e-02

Gene RIF (24)

AA Sequence

MLRRILQRTPGRVGSQGSDLDSSATPINTVDVNNESSSEGFICPQCMKSLGSADELFKHYEAVHDAGNDS      1 - 70
GHGGESNLALKRDDVTLLRQEVQDLQASLKEEKWYSEELKKELEKYQGLQQQEAKPDGLVTDSSAELQSL     71 - 140
EQQLEEAQTENFNIKQMKDLFEQKAAQLATEIADIKSKYDEERSLREAAEQKVTRLTEELNKEATVIQDL    141 - 210
KTELLQRPGIEDVAVLKKELVQVQTLMDNMTLERERESEKLKDECKKLQSQYASSEATISQLRSELAKGP    211 - 280
QEVAVYVQELQKLKSSVNELTQKNQTLTENLLKKEQDYTKLEEKHNEESVSKKNIQATLHQKDLDCQQLQ    281 - 350
SRLSASETSLHRIHVELSEKGEATQKLKEELSEVETKYQHLKAEFKQLQQQREEKEQHGLQLQSEINQLH    351 - 420
SKLLETERQLGEAHGRLKEQRQLSSEKLMDKEQQVADLQLKLSRLEEQLKEKVTNSTELQHQLDKTKQQH    421 - 490
QEQQALQQSTTAKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKENISLLEKEREDLYAKIQAGEGET    491 - 560
AVLNQLQEKNHTLQEQVTQLTEKLKNQSESHKQAQENLHDQVQEQKAHLRAAQDRVLSLETSVNELNSQL    561 - 630
NESKEKVSQLDIQIKAKTELLLSAEAAKTAQRADLQNHLDTAQNALQDKQQELNKITTQLDQVTAKLQDK    631 - 700
QEHCSQLESHLKEYKEKYLSLEQKTEELEGQIKKLEADSLEVKASKEQALQDLQQQRQLNTDLELRATEL    701 - 770
SKQLEMEKEIVSSTRLDLQKKSEALESIKQKLTKQEEEKKILKQDFETLSQETKIQHEELNNRIQTTVTE    771 - 840
LQKVKMEKEALMTELSTVKDKLSKVSDSLKNSKSEFEKENQKGKAAILDLEKTCKELKHQLQVQMENTLK    841 - 910
EQKELKKSLEKEKEASHQLKLELNSMQEQLIQAQNTLKQNEKEEQQLQGNINELKQSSEQKKKQIEALQG    911 - 980
ELKIAVLQKTELENKLQQQLTQAAQELAAEKEKISVLQNNYEKSQETFKQLQSDFYGRESELLATRQDLK    981 - 1050
SVEEKLSLAQEDLISNRNQIGNQNKLIQELKTAKATLEQDSAKKEQQLQERCKALQDIQKEKSLKEKELV   1051 - 1120
NEKSKLAEIEEIKCRQEKEITKLNEELKSHKLESIKEITNLKDAKQLLIQQKLELQGKADSLKAAVEQEK   1121 - 1190
RNQQILKDQVKKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEAKLTMQITALNENLGTVKKEWQSS   1191 - 1260
QRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQEL   1261 - 1330
GRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKPVR   1331 - 1400
VCDACFNDLQG                                                              1401 - 1411
//

Text Mined References (63)

PMID Year Title