Property Summary

NCBI Gene PubMed Count 15
PubMed Score 15.59
PubTator Score 14.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.674 0.000
Multiple myeloma 1.214 0.005
osteosarcoma 2.750 0.000
medulloblastoma 1.700 0.000
atypical teratoid/rhabdoid tumor 1.300 0.001
medulloblastoma, large-cell 1.900 0.000
primitive neuroectodermal tumor 1.200 0.000
adrenocortical carcinoma 1.021 0.035
non-small cell lung cancer 1.294 0.000
lung cancer 1.100 0.001
diabetes mellitus -1.500 0.002
Pick disease -1.500 0.000
progressive supranuclear palsy -1.800 0.004
invasive ductal carcinoma 1.200 0.016
acute myeloid leukemia -1.200 0.013
ovarian cancer 1.900 0.001

Synonym

Accession Q15072 Q2TB94
Symbols OZF

Gene

Gene RIF (2)

PMID Text
15881673 OZF interacts with UBC9, the E2 enzyme involved in the covalent conjugation of the small ubiquitin-like modifier 1 (SUMO-1).
15838871 OZF overexpression in tumours may alter the balance between hRap1 and other telomeric proteins; therefore OZF function may be linked to telomere regulation

AA Sequence

MSHLSQQRIYSGENPFACKVCGKVFSHKSNLTEHEHFHTREKPFECNECGKAFSQKQYVIKHQNTHTGEK      1 - 70
LFECNECGKSFSQKENLLTHQKIHTGEKPFECKDCGKAFIQKSNLIRHQRTHTGEKPFVCKECGKTFSGK     71 - 140
SNLTEHEKIHIGEKPFKCSECGTAFGQKKYLIKHQNIHTGEKPYECNECGKAFSQRTSLIVHVRIHSGDK    141 - 210
PYECNVCGKAFSQSSSLTVHVRSHTGEKPYGCNECGKAFSQFSTLALHLRIHTGKKPYQCSECGKAFSQK    211 - 280
SHHIRHQKIHTH                                                              281 - 292
//

Text Mined References (15)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15881673 2005 A Kruppel zinc finger of ZNF 146 interacts with the SUMO-1 conjugating enzyme UBC9 and is sumoylated in vivo.
15838871 2005 Zinc finger protein overexpressed in colon carcinoma interacts with the telomeric protein hRap1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12754738 2003 The zinc finger protein OZF (ZNF146) is overexpressed in colorectal cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11306801 2001 Genomic organization and promoter identification of ZNF146, a gene encoding a protein consisting solely of zinc finger domains.
More...