Property Summary

NCBI Gene PubMed Count 15
Grant Count 48
R01 Count 37
Funding $6,805,153.77
PubMed Score 785.84
PubTator Score 420.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.331 0.000
glioblastoma 1.100 0.009
lung cancer 1.100 0.027

Gene RIF (5)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20739282 Oxa1L-CTT undergoes conformational changes and induced oligomer formation when it binds to the ribosome.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20601428 the structure of the C-terminal tail of human Oxa1L (Oxa1L-CTT) and its interaction with the mitochondrial ribosome
19349278 Topogenesis of Oxa1 is a cooperative event of all five transmembrane segments (TM), and hexapeptide GLPWWG followed immediately by TM1 is essential for correct Oxa1 topogenesis.

AA Sequence

MAMGLMCGRRELLRLLQSGRRVHSVAGPSQWLGKPLTTRLLFPVAPCCCRPHYLFLAASGPRSLSTSAIS      1 - 70
FAEVQVQAPPVVAATPSPTAVPEVASGETADVVQTAAEQSFAELGLGSYTPVGLIQNLLEFMHVDLGLPW     71 - 140
WGAIAACTVFARCLIFPLIVTGQREAARIHNHLPEIQKFSSRIREAKLAGDHIEYYKASSEMALYQKKHG    141 - 210
IKLYKPLILPVTQAPIFISFFIALREMANLPVPSLQTGGLWWFQDLTVSDPIYILPLAVTATMWAVLELG    211 - 280
AETGVQSSDLQWMRNVIRMMPLITLPITMHFPTAVFMYWLSSNLFSLVQVSCLRIPAVRTVLKIPQRVVH    281 - 350
DLDKLPPREGFLESFKKGWKNAEMTRQLREREQRMRNQLELAARGPLRQTFTHNPLLQPGKDNPPNIPSS    351 - 420
SSKPKSKYPWHDTLG                                                           421 - 435
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20739282 2010 Identification of protein-protein and protein-ribosome interacting regions of the C-terminal tail of human mitochondrial inner membrane protein Oxa1L.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20601428 2010 Properties of the C-terminal tail of human mitochondrial inner membrane protein Oxa1L and its interactions with mammalian mitochondrial ribosomes.
19349278 2009 Topogenesis of mammalian Oxa1, a component of the mitochondrial inner membrane protein export machinery.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17936786 2007 Knockdown of human Oxa1l impairs the biogenesis of F1Fo-ATP synthase and NADH:ubiquinone oxidoreductase.
More...