Property Summary

NCBI Gene PubMed Count 15
PubMed Score 837.98
PubTator Score 420.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 2.6e-05
glioblastoma 5792 9.2e-03
lung cancer 4740 2.7e-02

Expression

  Differential Expression (3)

Disease log2 FC p
glioblastoma 1.100 9.2e-03
lung cancer 1.100 2.7e-02
osteosarcoma -1.331 2.6e-05

Gene RIF (5)

AA Sequence

MAMGLMCGRRELLRLLQSGRRVHSVAGPSQWLGKPLTTRLLFPVAPCCCRPHYLFLAASGPRSLSTSAIS      1 - 70
FAEVQVQAPPVVAATPSPTAVPEVASGETADVVQTAAEQSFAELGLGSYTPVGLIQNLLEFMHVDLGLPW     71 - 140
WGAIAACTVFARCLIFPLIVTGQREAARIHNHLPEIQKFSSRIREAKLAGDHIEYYKASSEMALYQKKHG    141 - 210
IKLYKPLILPVTQAPIFISFFIALREMANLPVPSLQTGGLWWFQDLTVSDPIYILPLAVTATMWAVLELG    211 - 280
AETGVQSSDLQWMRNVIRMMPLITLPITMHFPTAVFMYWLSSNLFSLVQVSCLRIPAVRTVLKIPQRVVH    281 - 350
DLDKLPPREGFLESFKKGWKNAEMTRQLREREQRMRNQLELAARGPLRQTFTHNPLLQPGKDNPPNIPSS    351 - 420
SSKPKSKYPWHDTLG                                                           421 - 435
//

Text Mined References (19)

PMID Year Title