Property Summary

NCBI Gene PubMed Count 36
Grant Count 2
R01 Count 1
Funding $240,399.6
PubMed Score 105.58
PubTator Score 244.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Rheumatoid Arthritis 1.400 0.008
pancreatic cancer 1.200 0.002
malignant mesothelioma -1.100 0.000
psoriasis 1.400 0.001
osteosarcoma -1.685 0.000
astrocytoma 1.500 0.001
medulloblastoma, large-cell -1.100 0.000
pancreatic ductal adenocarcinoma liver m... -1.079 0.015
intraductal papillary-mucinous adenoma (... 1.300 0.007
lung cancer 1.200 0.013
ulcerative colitis -2.300 0.000
interstitial cystitis -1.800 0.000
pancreatic carcinoma 1.200 0.002
aldosterone-producing adenoma -1.035 0.023
subependymal giant cell astrocytoma 1.422 0.016
spina bifida -1.352 0.029
ovarian cancer 1.700 0.000

Synonym

Accession Q15067 A8K6X8 A8KAA0 B4DK61 F5GYQ8 Q12863 Q15068 Q15101 Q16131 Q7Z3W5 Q9UD31 AOX
Symbols ACOX
SCOX
PALMCOX

Gene

PANTHER Protein Class (2)

 Grant Application (2)

Gene RIF (6)

PMID Text
24418004 Because patients with AOx deficiency suffer from more severe symptoms than those with X-ALD, accumulation of VLC-PUFA and/or reduction of DHA may be associated with the severity of peroxisomal diseases.
23933200 ACOX1 and GNPAT silencing up-regulated ceramide galactosyltransferase (UGT8) mRNA expression, and down-regulated UDP-glucoseceramide glucosyltransferase (UGCG).
20195242 Data show that human ACOX1b isoform is more effective than the ACOX1a isoform in reversing the Acox1 null phenotype in the mouse.
18660489 Observational study of gene-disease association. (HuGE Navigator)
18536048 report on two new patients with ACOX1 deficiency and mutational analyses
17458872 Mutational spectrum of peroxisomal acyl-coenzyme A oxidase deficiency.

AA Sequence

MNPDLRRERDSASFNPELLTHILDGSPEKTRRRREIENMILNDPDFQHEDLNFLTRSQRYEVAVRKSAIM      1 - 70
VKKMREFGIADPDEIMWFKKLHLVNFVEPVGLNYSMFIPTLLNQGTTAQKEKWLLSSKGLQIIGTYAQTE     71 - 140
MGHGTHLRGLETTATYDPETQEFILNSPTVTSIKWWPGGLGKTSNHAIVLAQLITKGKCYGLHAFIVPIR    141 - 210
EIGTHKPLPGITVGDIGPKFGYDEIDNGYLKMDNHRIPRENMLMKYAQVKPDGTYVKPLSNKLTYGTMVF    211 - 280
VRSFLVGEAARALSKACTIAIRYSAVRHQSEIKPGEPEPQILDFQTQQYKLFPLLATAYAFQFVGAYMKE    281 - 350
TYHRINEGIGQGDLSELPELHALTAGLKAFTSWTANTGIEACRMACGGHGYSHCSGLPNIYVNFTPSCTF    351 - 420
EGENTVMMLQTARFLMKSYDQVHSGKLVCGMVSYLNDLPSQRIQPQQVAVWPTMVDINSPESLTEAYKLR    421 - 490
AARLVEIAAKNLQKEVIHRKSKEVAWNLTSVDLVRASEAHCHYVVVKLFSEKLLKIQDKAIQAVLRSLCL    491 - 560
LYSLYGISQNAGDFLQGSIMTEPQITQVNQRVKELLTLIRSDAVALVDAFDFQDVTLGSVLGRYDGNVYE    561 - 630
NLFEWAKNSPLNKAEVHESYKHLKSLQSKL                                            631 - 660
//

Text Mined References (43)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24418004 2014 Very-long-chain polyunsaturated fatty acids accumulate in phosphatidylcholine of fibroblasts from patients with Zellweger syndrome and acyl-CoA oxidase1 deficiency.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23933200 2013 Altered phospholipid molecular species and glycolipid composition in brain, liver and fibroblasts of Zellweger syndrome.
23209302 2012 KIF14 negatively regulates Rap1a-Radil signaling during breast cancer progression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20195242 2010 Reversal of mouse Acyl-CoA oxidase 1 (ACOX1) null phenotype by human ACOX1b isoform [corrected].
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
19946888 2010 Defining the membrane proteome of NK cells.
More...