Property Summary

NCBI Gene PubMed Count 234
PubMed Score 747.55
PubTator Score 146.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Drug allergy 36
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.8
Disease Target Count Z-score Confidence
Macular degeneration 65 0.0 0.9
Osteoporosis 363 0.0 1.2

Expression

  Differential Expression (36)

Disease log2 FC p
acute quadriplegic myopathy 2.208 2.7e-03
adult high grade glioma 2.400 1.7e-03
Astrocytoma, Pilocytic 4.300 3.4e-08
atypical teratoid / rhabdoid tumor 1.900 7.8e-03
Breast cancer 3.600 2.2e-02
breast carcinoma 1.400 4.1e-04
cystic fibrosis -1.554 1.4e-03
Duchenne muscular dystrophy 2.201 2.9e-05
ductal carcinoma in situ 2.200 1.8e-02
esophageal adenocarcinoma 2.600 1.8e-02
fibroadenoma 1.900 2.1e-02
glioblastoma 2.300 9.2e-03
interstitial cystitis 1.100 2.5e-02
intraductal papillary-mucinous adenoma (... -1.100 1.3e-02
intraductal papillary-mucinous carcinoma... -3.100 9.5e-03
invasive ductal carcinoma 2.300 5.6e-03
juvenile dermatomyositis 3.028 2.1e-08
limb girdle muscular dystrophy 2A 1.322 4.4e-02
lung adenocarcinoma 1.200 2.9e-06
lung cancer 1.100 2.1e-02
lung carcinoma -1.500 9.9e-06
malignant mesothelioma -7.300 2.0e-08
medulloblastoma, large-cell 1.300 4.4e-02
nasopharyngeal carcinoma 1.800 2.9e-02
non-small cell lung cancer 3.145 1.7e-14
osteosarcoma 4.582 2.0e-04
ovarian cancer -2.700 1.1e-02
pancreatic cancer 2.700 1.3e-04
posterior fossa group A ependymoma 1.100 5.7e-03
primary pancreatic ductal adenocarcinoma 5.704 1.4e-04
primary Sjogren syndrome 2.300 2.1e-05
psoriasis -1.300 5.5e-06
Rhinitis 2.900 4.4e-02
rhinitis with controlled asthma 3.000 1.8e-02
ulcerative colitis 2.000 6.6e-03
X-linked cerebral adrenoleukodystrophy 2.000 4.7e-02

 CSPA Cell Line (3)

Gene RIF (222)

AA Sequence

MIPFLPMFSLLLLLIVNPINANNHYDKILAHSRIRGRDQGPNVCALQQILGTKKKYFSTCKNWYKKSICG      1 - 70
QKTTVLYECCPGYMRMEGMKGCPAVLPIDHVYGTLGIVGATTTQRYSDASKLREEIEGKGSFTYFAPSNE     71 - 140
AWDNLDSDIRRGLESNVNVELLNALHSHMINKRMLTKDLKNGMIIPSMYNNLGLFINHYPNGVVTVNCAR    141 - 210
IIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFE    211 - 280
KLPRGVLERIMGDKVASEALMKYHILNTLQCSESIMGGAVFETLEGNTIEIGCDGDSITVNGIKMVNKKD    281 - 350
IVTNNGVIHLIDQVLIPDSAKQVIELAGKQQTTFTDLVAQLGLASALRPDGEYTLLAPVNNAFSDDTLSM    351 - 420
DQRLLKLILQNHILKVKVGLNELYNGQILETIGGKQLRVFVYRTAVCIENSCMEKGSKQGRNGAIHIFRE    421 - 490
IIKPAEKSLHEKLKQDKRFSTFLSLLEAADLKELLTQPGDWTLFVPTNDAFKGMTSEEKEILIRDKNALQ    491 - 560
NIILYHLTPGVFIGKGFEPGVTNILKTTQGSKIFLKEVNDTLLVNELKSKESDIMTTNGVIHVVDKLLYP    561 - 630
ADTPVGNDQLLEILNKLIKYIQIKFVRGSTFKEIPVTVYTTKIITKVVEPKIKVIEGSLQPIIKTEGPTL    631 - 700
TKVKIEGEPEFRLIKEGETITEVIHGEPIIKKYTKIIDGVPVEITEKETREERIITGPEIKYTRISTGGG    701 - 770
ETEETLKKLLQEEVTKVTKFIEGGDGHLFEDEEIKRLLQGDTPVRKLQANKKVQGSRRRLREGRSQ        771 - 836
//

Text Mined References (238)

PMID Year Title