Property Summary

NCBI Gene PubMed Count 187
Grant Count 158
R01 Count 76
Funding $14,074,895.72
PubMed Score 617.11
PubTator Score 146.89

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q15063 B1ALD8 C0IMJ1 C0IMJ2 C0IMJ4 D2KRH7 F5H628 Q15064 Q29XZ0 Q3KPJ5 Q5VSY5 Q8IZF9 PN
Symbols PN
OSF2
OSF-2
PDLPOSTN

Gene

PANTHER Protein Class (1)

Gene RIF (176)

PMID Text
27028305 that Periostin expression was significantly (P < 0.05) higher in osteosarcoma (80.9%) than in osteochondroma
26996552 These findings suggest that the distribution pattern of periostin was broader as the clinical staging of the tumor progressed and found that isoprenaline upregulated expression levels of periostin in gastric cancer cells.
26890265 Periostin mediates intestinal inflammation through the activation of NF-kappaB signaling, which suggests that periostin is a potential therapeutic target for inflammatory bowel disease.
26872609 our findings suggest that the patterns of expression of PN in both compartments can allow for the development of IHC "signatures" that maintain a strong independent predictive value of both all causes and, namely, of cancer-specific mortality.
26820539 Thus, these results demonstrate a subcellular role of periostin in promotion of fibronectin secretion from the ER.
26750768 Our results clearly demonstrated that inhibiting the pro-migratory function of POSTN by the overexpression of miR-Let-7f significantly reduced the formation of vasculogenic mimicry
26723972 POSTN expression increased in adamantinomatous craniopharyngioma-associated fibroblasts. Overexpressed POSTN significantly elevated the EMT of ACP cells by regulating the expression of associated genes.
26716408 High levels of stromal POSTN tend to have higher percentage of cisplatin resistance in epithelial ovarian carcinoma.
26709124 Quercetin suppresses the production of both periostin and periostin-induced eosinophil chemoattractants.
26556874 Data indicate that stromal periostin (POSTN) expression predicted the prognosis of colorectal carcinoma (CRC) patients who received postoperative chemotherapy.
More...

AA Sequence

MIPFLPMFSLLLLLIVNPINANNHYDKILAHSRIRGRDQGPNVCALQQILGTKKKYFSTCKNWYKKSICG      1 - 70
QKTTVLYECCPGYMRMEGMKGCPAVLPIDHVYGTLGIVGATTTQRYSDASKLREEIEGKGSFTYFAPSNE     71 - 140
AWDNLDSDIRRGLESNVNVELLNALHSHMINKRMLTKDLKNGMIIPSMYNNLGLFINHYPNGVVTVNCAR    141 - 210
IIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFE    211 - 280
KLPRGVLERIMGDKVASEALMKYHILNTLQCSESIMGGAVFETLEGNTIEIGCDGDSITVNGIKMVNKKD    281 - 350
IVTNNGVIHLIDQVLIPDSAKQVIELAGKQQTTFTDLVAQLGLASALRPDGEYTLLAPVNNAFSDDTLSM    351 - 420
DQRLLKLILQNHILKVKVGLNELYNGQILETIGGKQLRVFVYRTAVCIENSCMEKGSKQGRNGAIHIFRE    421 - 490
IIKPAEKSLHEKLKQDKRFSTFLSLLEAADLKELLTQPGDWTLFVPTNDAFKGMTSEEKEILIRDKNALQ    491 - 560
NIILYHLTPGVFIGKGFEPGVTNILKTTQGSKIFLKEVNDTLLVNELKSKESDIMTTNGVIHVVDKLLYP    561 - 630
ADTPVGNDQLLEILNKLIKYIQIKFVRGSTFKEIPVTVYTTKIITKVVEPKIKVIEGSLQPIIKTEGPTL    631 - 700
TKVKIEGEPEFRLIKEGETITEVIHGEPIIKKYTKIIDGVPVEITEKETREERIITGPEIKYTRISTGGG    701 - 770
ETEETLKKLLQEEVTKVTKFIEGGDGHLFEDEEIKRLLQGDTPVRKLQANKKVQGSRRRLREGRSQ        771 - 836
//

Text Mined References (191)

PMID Year Title
27028305 2016 High-level expression of periostin is significantly correlated with tumour angiogenesis and poor prognosis in osteosarcoma.
26996552 2016 Isoprenaline Induces Periostin Expression in Gastric Cancer.
26890265 2016 Matricellular Protein Periostin Mediates Intestinal Inflammation through the Activation of Nuclear Factor ?B Signaling.
26872609 2016 The prognostic value of stromal and epithelial periostin expression in human breast cancer: correlation with clinical pathological features and mortality outcome.
26820539 2016 Periostin promotes secretion of fibronectin from the endoplasmic reticulum.
26750768 2016 MicroRNA-Let-7f reduces the vasculogenic mimicry of human glioma cells by regulating periostin-dependent migration.
26723972 2016 Periostin activates pathways involved in epithelial-mesenchymal transition in adamantinomatous craniopharyngioma.
26716408 2016 Periostin in tumor microenvironment is associated with poor prognosis and platinum resistance in epithelial ovarian carcinoma.
26709124 Suppressive Activity of Quercetin on Periostin Functions In Vitro.
26556874 2016 Periostin expression in intra-tumoral stromal cells is prognostic and predictive for colorectal carcinoma via creating a cancer-supportive niche.
More...