Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.44
PubTator Score 6.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
colon cancer 1478 2.0e-06
acute quadriplegic myopathy 1158 2.1e-06
osteosarcoma 7950 1.6e-05
lung cancer 4740 1.4e-04
ovarian cancer 8520 3.3e-04
psoriasis 6694 3.4e-04
gastric carcinoma 807 7.8e-03
group 3 medulloblastoma 4104 1.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Treacher Collins syndrome 27 3.816 1.9

Expression

  Differential Expression (8)

Disease log2 FC p
acute quadriplegic myopathy 1.107 2.1e-06
colon cancer 1.600 2.0e-06
gastric carcinoma 1.200 7.8e-03
group 3 medulloblastoma 1.200 1.6e-02
lung cancer 1.800 1.4e-04
osteosarcoma -1.937 1.6e-05
ovarian cancer 1.400 3.3e-04
psoriasis -2.000 3.4e-04

 GO Function (1)

AA Sequence

MAAGGGGSCDPLAPAGVPCAFSPHSQAYFALASTDGHLRVWETANNRLHQEYVPSAHLSGTCTCLAWAPA      1 - 70
RLQAKESPQRKKRKSEAVGMSNQTDLLALGTAVGSILLYSTVKGELHSKLISGGHDNRVNCIQWHQDSGC     71 - 140
LYSCSDDKHIVEWNVQTCKVKCKWKGDNSSVSSLCISPDGKMLLSAGRTIKLWVLETKEVYRHFTGHATP    141 - 210
VSSLMFTTIRPPNESQPFDGITGLYFLSGAVHDRLLNVWQVRSENKEKSAVMSFTVTDEPVYIDLTLSEN    211 - 280
KEEPVKLAVVCRDGQVHLFEHILNGYCKKPLTSNCTIQIATPGKGKKSTPKPIPILAAGFCSDKMSLLLV    281 - 350
YGSWFQPTIERVALNSREPHMCLVRDISNCWAPKVETAITKVRTPVMNSEAKVLVPGIPGHHAAIKPAPP    351 - 420
QTEQVESKRKSGGNEVSIEERLGAMDIDTHKKGKEDLQTNSFPVLLTQGLESNDFEMLNKVLQTRNVNLI    421 - 490
KKTVLRMPLHTIIPLLQELTKRLQGHPNSAVLMVQWLKCVLTVHASYLSTLPDLVPQLGTLYQLMESRVK    491 - 560
TFQKLSHLHGKLILLITQVTASEKTKGATSPGQKAKLVYEEESSEEESDDEIADKDSEDNWDEDEEESES    561 - 630
EKDEDVEEEDEDAEGKDEENGEDRDTASEKELNGDSDLDPENESEEE                           631 - 677
//

Text Mined References (21)

PMID Year Title