Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.44
PubTator Score 6.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -2.000 0.000
osteosarcoma -1.937 0.000
acute quadriplegic myopathy 1.107 0.000
lung cancer 2.000 0.000
colon cancer 1.600 0.000
group 3 medulloblastoma 1.200 0.016
gastric carcinoma 1.200 0.008
ovarian cancer 1.400 0.000

AA Sequence

MAAGGGGSCDPLAPAGVPCAFSPHSQAYFALASTDGHLRVWETANNRLHQEYVPSAHLSGTCTCLAWAPA      1 - 70
RLQAKESPQRKKRKSEAVGMSNQTDLLALGTAVGSILLYSTVKGELHSKLISGGHDNRVNCIQWHQDSGC     71 - 140
LYSCSDDKHIVEWNVQTCKVKCKWKGDNSSVSSLCISPDGKMLLSAGRTIKLWVLETKEVYRHFTGHATP    141 - 210
VSSLMFTTIRPPNESQPFDGITGLYFLSGAVHDRLLNVWQVRSENKEKSAVMSFTVTDEPVYIDLTLSEN    211 - 280
KEEPVKLAVVCRDGQVHLFEHILNGYCKKPLTSNCTIQIATPGKGKKSTPKPIPILAAGFCSDKMSLLLV    281 - 350
YGSWFQPTIERVALNSREPHMCLVRDISNCWAPKVETAITKVRTPVMNSEAKVLVPGIPGHHAAIKPAPP    351 - 420
QTEQVESKRKSGGNEVSIEERLGAMDIDTHKKGKEDLQTNSFPVLLTQGLESNDFEMLNKVLQTRNVNLI    421 - 490
KKTVLRMPLHTIIPLLQELTKRLQGHPNSAVLMVQWLKCVLTVHASYLSTLPDLVPQLGTLYQLMESRVK    491 - 560
TFQKLSHLHGKLILLITQVTASEKTKGATSPGQKAKLVYEEESSEEESDDEIADKDSEDNWDEDEEESES    561 - 630
EKDEDVEEEDEDAEGKDEENGEDRDTASEKELNGDSDLDPENESEEE                           631 - 677
//

Text Mined References (20)

PMID Year Title
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24754225 2014 Dynamics of WD-repeat containing proteins in SSU processome components.
24219289 2013 Interaction, mobility, and phosphorylation of human orthologues of WD repeat-containing components of the yeast SSU processome t-UTP sub-complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22916032 2012 NOL11, implicated in the pathogenesis of North American Indian childhood cirrhosis, is required for pre-rRNA transcription and processing.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...