Property Summary

NCBI Gene PubMed Count 23
Grant Count 25
R01 Count 20
Funding $3,213,386.31
PubMed Score 169.57
PubTator Score 25.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.583 0.000
astrocytoma 1.900 0.004
pancreatic ductal adenocarcinoma liver m... 1.139 0.031
group 4 medulloblastoma 1.200 0.000
subependymal giant cell astrocytoma -1.093 0.043
ovarian cancer 2.000 0.000

Gene RIF (8)

PMID Text
26947130 An isoform of BRD3, BRD3R (BRD3 with Reprogramming activity) is a reprogramming factor.
24565511 Here, we identify NCT, a complex comprising the Nrc1 BET-family tandem bromodomain protein (SPAC631.02), casein kinase II (CKII), and several TAFs, as a regulator of condensin function.
24049186 BRD2, BRD3, and BRD4 interact with gammaretroviral INs and serve as cofactors for murine leukemia virus integration.
22035730 The BRDT gene was not expressed in testicular tissue from patients with Sertoli cells only, whereas the other three genes of the BET family retained expression in all the sperm pathologies.
21555453 the structural basis for GATA1 and Brd3 interaction was described.
18406326 Results report that the double bromodomain proteins Brd2 and Brd3 associate preferentially in vivo with hyperacetylated chromatin along the entire lengths of transcribed genes.
17934517 BRD-NUT fusion proteins contribute to carcinogenesis by associating with chromatin and interfering with epithelial differentiation.
12371535 Activated lymphocytes induced by mitogens or antigens express various sets of genes, including those involved in the expression of cytokines, surface molecules, and nuclear proteins.

AA Sequence

MSTATTVAPAGIPATPGPVNPPPPEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNL      1 - 70
PDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQM     71 - 140
PQEEVELLPPAPKGKGRKPAAGAQSAGTQQVAAVSSVSPATPFQSVPPTVSQTPVIAATPVPTITANVTS    141 - 210
VPVPPAAAPPPPATPIVPVVPPTPPVVKKKGVKRKADTTTPTTSAITASRSESPPPLSDPKQAKVVARRE    211 - 280
SGGRPIKPPKKDLEDGEVPQHAGKKGKLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHD    281 - 350
IIKHPMDLSTVKRKMDGREYPDAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPV    351 - 420
EAPALPAPAAPMVSKGAESSRSSEESSSDSGSSDSEEERATRLAELQEQLKAVHEQLAALSQAPVNKPKK    421 - 490
KKEKKEKEKKKKDKEKEKEKHKVKAEEEKKAKVAPPAKQAQQKKAPAKKANSTTTAGRQLKKGGKQASAS    491 - 560
YDSEEEEEGLPMSYDEKRQLSLDINRLPGEKLGRVVHIIQSREPSLRDSNPDEIEIDFETLKPTTLRELE    561 - 630
RYVKSCLQKKQRKPFSASGKKQAAKSKEELAQEKKKELEKRLQDVSGQLSSSKKPARKEKPGSAPSGGPS    631 - 700
RLSSSSSSESGSSSSSGSSSDSSDSE                                                701 - 726
//

Text Mined References (31)

PMID Year Title
26947130 2016 The acetyllysine reader BRD3R promotes human nuclear reprogramming and regulates mitosis.
24565511 2014 Identification of a BET family bromodomain/casein kinase II/TAF-containing complex as a regulator of mitotic condensin function.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24049186 2013 Bromo- and extraterminal domain chromatin regulators serve as cofactors for murine leukemia virus integration.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22464331 2012 Histone recognition and large-scale structural analysis of the human bromodomain family.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
22035730 2012 Expression of BET genes in testis of men with different spermatogenic impairments.
21555453 2011 Structural basis and specificity of acetylated transcription factor GATA1 recognition by BET family bromodomain protein Brd3.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...