Property Summary

Ligand Count 229
NCBI Gene PubMed Count 27
PubMed Score 177.19
PubTator Score 25.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
medulloblastoma 720 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Botulism 24 4.205 2.1
Cancer 2499 3.329 1.7

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma 1.900 4.2e-03
group 4 medulloblastoma 1.200 5.2e-06
osteosarcoma -1.583 4.3e-04
ovarian cancer -1.400 1.3e-06
pancreatic ductal adenocarcinoma liver m... 1.139 3.1e-02
subependymal giant cell astrocytoma -1.093 4.3e-02

Protein-protein Interaction (2)

Gene RIF (11)

AA Sequence

MSTATTVAPAGIPATPGPVNPPPPEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNL      1 - 70
PDYHKIIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQM     71 - 140
PQEEVELLPPAPKGKGRKPAAGAQSAGTQQVAAVSSVSPATPFQSVPPTVSQTPVIAATPVPTITANVTS    141 - 210
VPVPPAAAPPPPATPIVPVVPPTPPVVKKKGVKRKADTTTPTTSAITASRSESPPPLSDPKQAKVVARRE    211 - 280
SGGRPIKPPKKDLEDGEVPQHAGKKGKLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHD    281 - 350
IIKHPMDLSTVKRKMDGREYPDAQGFAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPV    351 - 420
EAPALPAPAAPMVSKGAESSRSSEESSSDSGSSDSEEERATRLAELQEQLKAVHEQLAALSQAPVNKPKK    421 - 490
KKEKKEKEKKKKDKEKEKEKHKVKAEEEKKAKVAPPAKQAQQKKAPAKKANSTTTAGRQLKKGGKQASAS    491 - 560
YDSEEEEEGLPMSYDEKRQLSLDINRLPGEKLGRVVHIIQSREPSLRDSNPDEIEIDFETLKPTTLRELE    561 - 630
RYVKSCLQKKQRKPFSASGKKQAAKSKEELAQEKKKELEKRLQDVSGQLSSSKKPARKEKPGSAPSGGPS    631 - 700
RLSSSSSSESGSSSSSGSSSDSSDSE                                                701 - 726
//

Text Mined References (36)

PMID Year Title