Property Summary

NCBI Gene PubMed Count 34
PubMed Score 29.75
PubTator Score 32.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
psoriasis 6685 8.61924893645543E-77
non-small cell lung cancer 2798 3.10989185509016E-32
Breast cancer 3099 2.32633149919494E-15
group 3 medulloblastoma 2254 2.05090142513544E-10
glioblastoma 5572 4.46225601065145E-10
lung adenocarcinoma 2714 5.19720553976608E-9
atypical teratoid / rhabdoid tumor 4369 2.07922857456555E-8
medulloblastoma, large-cell 6234 2.0983073287806E-8
pediatric high grade glioma 2712 2.15342980664048E-8
malignant mesothelioma 3163 9.86679383004072E-7
lung cancer 4473 1.92184762012299E-6
Atopic dermatitis 944 2.02674665663818E-6
posterior fossa group A ependymoma 1511 2.75556899432915E-6
pancreatic cancer 2300 4.7002329842917E-6
ovarian cancer 8492 6.44398665412451E-6
primitive neuroectodermal tumor 3031 1.28866596974185E-5
pilocytic astrocytoma 3086 3.52196167212781E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 4.01235477149201E-5
ulcerative colitis 2087 5.52076016770626E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 9.89375200881309E-5
invasive ductal carcinoma 2950 1.17772357661663E-4
nasopharyngeal carcinoma 1056 1.52870842118551E-4
adrenocortical carcinoma 1427 0.00188784499926959
Endometriosis 535 0.00665278127062265
interstitial cystitis 2299 0.0103746675602248
colon cancer 1475 0.0127145161454214
ductal carcinoma in situ 1745 0.028798722668543
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

Synonym

Accession Q15058 Q14CI8 Q4G0A5 Q5T1W3
Symbols MKS12

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

 GWAS Trait (1)

Gene RIF (27)

PMID Text
25528264 High-grade serous ovarian cancer cells may depend on KIF14 for in vitro proliferation.
25348260 Kinesin-14 blocks microtubule nucleation in yeast and reveal that this inhibition is countered by the kinesin-5 protein, Cut7.[Cut7, Pkl1]
25106407 High KIF14 expression is associated with hepatocellular carcinoma.
24854087 KIF14 knockdown downregulates the expression of Skp2 and Cks1, leading to accumulation of p27Kip1.
24784001 critical role for KIF14 in the tumorigenic potential of triple-negative breast cancer
24626475 analysis of epigenetic regulation of KIF14 overexpression in ovarian cancer
24128419 Mutations in KIF14 identified as a novel cause of an autosomal recessive lethal fetal ciliopathy phenotype.
23626713 KIF14 inhibits tumor growth and cancer metastasis in lung adenocarcinoma.
23479679 Data indicate that KIF14 and TLN1 loss-of-function significantly enhanced chemosensitivity in four triple-negative breast cancer (TNBC) cell lines.
23414349 Suppression of KIF14 not only decreases cancer cell migration but also induces apoptosis of cells.
More...

AA Sequence

MSLHSTHNRNNSGDILDIPSSQNSSSLNALTHSSRLKLHLKSDMSECENDDPLLRSAGKVRDINRTYVIS      1 - 70
ASRKTADMPLTPNPVGRLALQRRTTRNKESSLLVSELEDTTEKTAETRLTLQRRAKTDSAEKWKTAEIDS     71 - 140
VKMTLNVGGETENNGVSKESRTNVRIVNNAKNSFVASSVPLDEDPQVIEMMADKKYKETFSAPSRANENV    141 - 210
ALKYSSNRPPIASLSQTEVVRSGHLTTKPTQSKLDIKVLGTGNLYHRSIGKEIAKTSNKFGSLEKRTPTK    211 - 280
CTTEHKLTTKCSLPQLKSPAPSILKNRMSNLQVKQRPKSSFLANKQERSAENTILPEEETVVQNTSAGKD    281 - 350
PLKVENSQVTVAVRVRPFTKREKIEKASQVVFMSGKEITVEHPDTKQVYNFIYDVSFWSFDECHPHYASQ    351 - 420
TTVYEKLAAPLLERAFEGFNTCLFAYGQTGSGKSYTMMGFSEEPGIIPRFCEDLFSQVARKQTQEVSYHI    421 - 490
EMSFFEVYNEKIHDLLVCKDENGQRKQPLRVREHPVYGPYVEALSMNIVSSYADIQSWLELGNKQRATAA    491 - 560
TGMNDKSSRSHSVFTLVMTQTKTEFVEGEEHDHRITSRINLIDLAGSERCSTAHTNGDRLKEGVSINKSL    561 - 630
LTLGKVISALSEQANQRSVFIPYRESVLTWLLKESLGGNSKTAMIATISPAASNIEETLSTLRYANQARL    631 - 700
IVNIAKVNEDMNAKLIRELKAEIAKLKAAQRNSRNIDPERYRLCRQEITSLRMKLHQQERDMAEMQRVWK    701 - 770
EKFEQAEKRKLQETKELQKAGIMFQMDNHLPNLVNLNEDPQLSEMLLYMIKEGTTTVGKYKPNSSHDIQL    771 - 840
SGVLIADDHCTIKNFGGTVSIIPVGEAKTYVNGKHILEITVLRHGDRVILGGDHYFRFNHPVEVQKGKRP    841 - 910
SGRDTPISEGPKDFEFAKNELLMAQRSQLEAEIKEAQLKAKEEMMQGIQIAKEMAQQELSSQKAAYESKI    911 - 980
KALEAELREESQRKKMQEINNQKANHKIEELEKAKQHLEQEIYVNKKRLEMETLATKQALEDHSIRHARI    981 - 1050
LEALETEKQKIAKEVQILQQNRNNRDKTFTVQTTWSSMKLSMMIQEANAISSKLKTYYVFGRHDISDKSS   1051 - 1120
SDTSIRVRNLKLGISTFWSLEKFESKLAAMKELYESNGSNRGEDAFCDPEDEWEPDITDAPVSSLSRRRS   1121 - 1190
RSLMKNRRISGCLHDIQVHPIKNLHSSHSSGLMDKSSTIYSNSAESFLPGICKELIGSSLDFFGQSYDEE   1191 - 1260
RTIADSLINSFLKIYNGLFAISKAHEEQDEESQDNLFSSDRAIQSLTIQTACAFEQLVVLMKHWLSDLLP   1261 - 1330
CTNIARLEDELRQEVKKLGGYLQLFLQGCCLDISSMIKEAQKNAIQIVQQAVKYVGQLAVLKGSKLHFLE   1331 - 1400
NGNNKAASVQEEFMDAVCDGVGLGMKILLDSGLEKAKELQHELFRQCTKNEVTKEMKTNAMGLIRSLENI   1401 - 1470
FAESKIKSFRRQVQEENFEYQDFKRMVNRAPEFLKLKHCLEKAIEIIISALKGCHSDINLLQTCVESIRN   1471 - 1540
LASDFYSDFSVPSTSVGSYESRVTHIVHQELESLAKSLLFCFESEESPDLLKPWETYNQNTKEEHQQSKS   1541 - 1610
SGIDGSKNKGVPKRVYELHGSSPAVSSEECTPSRIQWV                                   1611 - 1648
//

Text Mined References (40)

PMID Year Title
25528264 2014 The role of KIF14 in patient-derived primary cultures of high-grade serous ovarian cancer cells.
25348260 2014 Kinesin-14 and kinesin-5 antagonistically regulate microtubule nucleation by ?-TuRC in yeast and human cells.
25106407 2014 Sox17 inhibits hepatocellular carcinoma progression by downregulation of KIF14 expression.
24854087 2014 Silencing of KIF14 interferes with cell cycle progression and cytokinesis by blocking the p27(Kip1) ubiquitination pathway in hepatocellular carcinoma.
24784001 2014 KIF14 promotes AKT phosphorylation and contributes to chemoresistance in triple-negative breast cancer.
24626475 2014 Transcriptional and epigenetic regulation of KIF14 overexpression in ovarian cancer.
24128419 2014 Exome sequencing identifies mutations in KIF14 as a novel cause of an autosomal recessive lethal fetal ciliopathy phenotype.
23626713 2013 The motor protein KIF14 inhibits tumor growth and cancer metastasis in lung adenocarcinoma.
23479679 2013 A targeted RNAi screen of the breast cancer genome identifies KIF14 and TLN1 as genes that modulate docetaxel chemosensitivity in triple-negative breast cancer.
23414349 2013 Suppression of KIF14 expression inhibits hepatocellular carcinoma progression and predicts favorable outcome.
More...