Property Summary

NCBI Gene PubMed Count 39
PubMed Score 34.02
PubTator Score 32.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.5

Expression

  Differential Expression (27)

Disease log2 FC p
adrenocortical carcinoma 1.421 4.0e-03
adult high grade glioma 2.500 3.7e-05
Astrocytoma, Pilocytic 1.100 4.3e-05
Atopic dermatitis 2.300 2.0e-06
atypical teratoid / rhabdoid tumor 2.800 8.7e-09
Breast cancer 1.800 2.3e-11
colon cancer 1.600 3.6e-02
ductal carcinoma in situ 1.600 1.6e-02
Endometriosis 1.699 6.7e-03
ependymoma 1.500 9.4e-05
glioblastoma 3.200 4.2e-10
group 3 medulloblastoma 3.300 3.0e-09
interstitial cystitis 1.100 1.0e-02
intraductal papillary-mucinous carcinoma... 2.200 4.0e-05
intraductal papillary-mucinous neoplasm ... 1.600 3.0e-04
invasive ductal carcinoma 1.900 2.0e-04
lung adenocarcinoma 1.400 5.2e-09
lung cancer 2.300 3.6e-04
malignant mesothelioma 1.400 9.9e-07
medulloblastoma, large-cell 3.800 2.1e-07
nasopharyngeal carcinoma 1.600 1.9e-04
non-small cell lung cancer 2.598 3.1e-32
ovarian cancer 2.400 6.4e-06
pancreatic cancer 1.500 4.7e-06
primitive neuroectodermal tumor 3.700 8.2e-06
psoriasis 1.400 4.5e-10
ulcerative colitis 1.300 5.5e-05

 OMIM Phenotype (1)

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (32)

AA Sequence

MSLHSTHNRNNSGDILDIPSSQNSSSLNALTHSSRLKLHLKSDMSECENDDPLLRSAGKVRDINRTYVIS      1 - 70
ASRKTADMPLTPNPVGRLALQRRTTRNKESSLLVSELEDTTEKTAETRLTLQRRAKTDSAEKWKTAEIDS     71 - 140
VKMTLNVGGETENNGVSKESRTNVRIVNNAKNSFVASSVPLDEDPQVIEMMADKKYKETFSAPSRANENV    141 - 210
ALKYSSNRPPIASLSQTEVVRSGHLTTKPTQSKLDIKVLGTGNLYHRSIGKEIAKTSNKFGSLEKRTPTK    211 - 280
CTTEHKLTTKCSLPQLKSPAPSILKNRMSNLQVKQRPKSSFLANKQERSAENTILPEEETVVQNTSAGKD    281 - 350
PLKVENSQVTVAVRVRPFTKREKIEKASQVVFMSGKEITVEHPDTKQVYNFIYDVSFWSFDECHPHYASQ    351 - 420
TTVYEKLAAPLLERAFEGFNTCLFAYGQTGSGKSYTMMGFSEEPGIIPRFCEDLFSQVARKQTQEVSYHI    421 - 490
EMSFFEVYNEKIHDLLVCKDENGQRKQPLRVREHPVYGPYVEALSMNIVSSYADIQSWLELGNKQRATAA    491 - 560
TGMNDKSSRSHSVFTLVMTQTKTEFVEGEEHDHRITSRINLIDLAGSERCSTAHTNGDRLKEGVSINKSL    561 - 630
LTLGKVISALSEQANQRSVFIPYRESVLTWLLKESLGGNSKTAMIATISPAASNIEETLSTLRYANQARL    631 - 700
IVNIAKVNEDMNAKLIRELKAEIAKLKAAQRNSRNIDPERYRLCRQEITSLRMKLHQQERDMAEMQRVWK    701 - 770
EKFEQAEKRKLQETKELQKAGIMFQMDNHLPNLVNLNEDPQLSEMLLYMIKEGTTTVGKYKPNSSHDIQL    771 - 840
SGVLIADDHCTIKNFGGTVSIIPVGEAKTYVNGKHILEITVLRHGDRVILGGDHYFRFNHPVEVQKGKRP    841 - 910
SGRDTPISEGPKDFEFAKNELLMAQRSQLEAEIKEAQLKAKEEMMQGIQIAKEMAQQELSSQKAAYESKI    911 - 980
KALEAELREESQRKKMQEINNQKANHKIEELEKAKQHLEQEIYVNKKRLEMETLATKQALEDHSIRHARI    981 - 1050
LEALETEKQKIAKEVQILQQNRNNRDKTFTVQTTWSSMKLSMMIQEANAISSKLKTYYVFGRHDISDKSS   1051 - 1120
SDTSIRVRNLKLGISTFWSLEKFESKLAAMKELYESNGSNRGEDAFCDPEDEWEPDITDAPVSSLSRRRS   1121 - 1190
RSLMKNRRISGCLHDIQVHPIKNLHSSHSSGLMDKSSTIYSNSAESFLPGICKELIGSSLDFFGQSYDEE   1191 - 1260
RTIADSLINSFLKIYNGLFAISKAHEEQDEESQDNLFSSDRAIQSLTIQTACAFEQLVVLMKHWLSDLLP   1261 - 1330
CTNIARLEDELRQEVKKLGGYLQLFLQGCCLDISSMIKEAQKNAIQIVQQAVKYVGQLAVLKGSKLHFLE   1331 - 1400
NGNNKAASVQEEFMDAVCDGVGLGMKILLDSGLEKAKELQHELFRQCTKNEVTKEMKTNAMGLIRSLENI   1401 - 1470
FAESKIKSFRRQVQEENFEYQDFKRMVNRAPEFLKLKHCLEKAIEIIISALKGCHSDINLLQTCVESIRN   1471 - 1540
LASDFYSDFSVPSTSVGSYESRVTHIVHQELESLAKSLLFCFESEESPDLLKPWETYNQNTKEEHQQSKS   1541 - 1610
SGIDGSKNKGVPKRVYELHGSSPAVSSEECTPSRIQWV                                   1611 - 1648
//

Text Mined References (45)

PMID Year Title