Property Summary

NCBI Gene PubMed Count 32
Grant Count 134
R01 Count 82
Funding $15,646,606.81
PubMed Score 18.87
PubTator Score 234.99

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q15054 B7ZAI6 Q32MZ9 Q32N00
Symbols P66
P68
PPP1R128

Gene

PDB

3E0J   1U76   2N1G  

 GWAS Trait (1)

Gene RIF (13)

PMID Text
26982350 Data suggest that relatively high affinity binding of PolD3-RIR motif to Rev1-C-terminal domain displaces subunits from PolN, Pol-iota, or PolK from Rev1 complex and promotes formation of Rev1/PolZ4 assembly with PCNA for translesion DNA replication.
25497329 POLD3 is SUMOylated by SUMO2 in response to replication stress and could play an important role in the regulation of cellular response to DNA replication stress.
24310611 In a cyclin E overexpression model of DNA replication stress, POLD3, the human ortholog of POL32, was required for cell cycle progression and processive DNA synthesis.
24035200 Findings provide evidence for the novel concept that Pol delta3 has a role in lagging strand synthesis, and that both forms of Pol delta3 and 4 may participate in DNA replication in higher eukaryotic cells.
22801543 Pol delta3 is the predominant form of Pol delta at sites of UV damage as a result of p12 degradation; results show that Pol delta at the DNA damage site is the Pol delta trimer lacking p12 regardless of the cell cycle phase
22634755 We identified three new CRC risk loci at 6p21 (rs1321311, near CDKN1A; P = 1.14 x 10(-10)), 11q13.4 (rs3824999, intronic to POLD3; P = 3.65 x 10(-10)) and Xp22.2 (rs5934683, near SHROOM2; P = 7.30 x 10(-10)).
22148433 Serine-458, located in the proliferating cell nuclear antigen (PCNA)-interacting motif of Poldelta(p68), is a phosphorylation site for protein kinase A (PKA); p68 mutation results in decreased p68 affinity for PCNA as well as processivity of Poldelta.
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
18818516 the crystal structure of p50*p66(N) complex featuring oligonucleotide binding and phosphodiesterase domains in winged helix-turn-helix N-terminal domain in p66
18765914 As a first step towards understanding the functional importance of their regulatory subunit interactions, the three-dimensional structure of the p50-p66 heterodimer of human Pol delta has been solved using X-ray crystallography.
More...

AA Sequence

MADQLYLENIDEFVTDQNKIVTYKWLSYTLGVHVNQAKQMLYDYVERKRKENSGAQLHVTYLVSGSLIQN      1 - 70
GHSCHKVAVVREDKLEAVKSKLAVTASIHVYSIQKAMLKDSGPLFNTDYDILKSNLQNCSKFSAIQCAAA     71 - 140
VPRAPAESSSSSKKFEQSHLHMSSETQANNELTTNGHGPPASKQVSQQPKGIMGMFASKAAAKTQETNKE    141 - 210
TKTEAKEVTNASAAGNKAPGKGNMMSNFFGKAAMNKFKVNLDSEQAVKEEKIVEQPTVSVTEPKLATPAG    211 - 280
LKKSSKKAEPVKVLQKEKKRGKRVALSDDETKETENMRKKRRRIKLPESDSSEDEVFPDSPGAYEAESPS    281 - 350
PPPPPSPPLEPVPKTEPEPPSVKSSSGENKRKRKRVLKSKTYLDGEGCIVTEKVYESESCTDSEEELNMK    351 - 420
TSSVHRPPAMTVKKEPREERKGPKKGTAALGKANRQVSITGFFQRK                            421 - 466
//

Text Mined References (46)

PMID Year Title
26982350 2016 Interaction between the Rev1 C-Terminal Domain and the PolD3 Subunit of Pol? Suggests a Mechanism of Polymerase Exchange upon Rev1/Pol?-Dependent Translesion Synthesis.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25497329 2015 Proteome-wide analysis of SUMO2 targets in response to pathological DNA replication stress in human cells.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24310611 2014 Break-induced replication repair of damaged forks induces genomic duplications in human cells.
24035200 2013 Dynamics of enzymatic interactions during short flap human Okazaki fragment processing by two forms of human DNA polymerase ?.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22801543 2012 Spatiotemporal recruitment of human DNA polymerase delta to sites of UV damage.
22634755 2012 Common variation near CDKN1A, POLD3 and SHROOM2 influences colorectal cancer risk.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
More...