Property Summary

NCBI Gene PubMed Count 46
PubMed Score 41.13
PubTator Score 24.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (25)

Disease log2 FC p
acute quadriplegic myopathy -1.052 5.1e-04
adult high grade glioma 1.500 4.5e-05
astrocytic glioma 1.600 3.0e-02
Astrocytoma, Pilocytic 2.400 1.9e-11
Breast cancer -1.500 1.8e-05
colon cancer -1.200 4.9e-02
cystic fibrosis 1.338 6.7e-05
ductal carcinoma in situ -1.500 1.6e-04
glioblastoma 1.400 1.3e-07
group 4 medulloblastoma -1.400 7.2e-05
intraductal papillary-mucinous carcinoma... -2.000 4.2e-03
intraductal papillary-mucinous neoplasm ... -2.100 5.4e-03
invasive ductal carcinoma -1.700 5.4e-04
lung adenocarcinoma -1.300 2.0e-13
lung cancer -2.900 1.1e-05
lung carcinoma -2.000 2.9e-26
medulloblastoma, large-cell -1.700 1.8e-03
non-small cell lung cancer -1.591 1.1e-18
oligodendroglioma 1.200 3.1e-11
ovarian cancer -1.900 1.5e-08
psoriasis -1.100 9.9e-06
subependymal giant cell astrocytoma 1.734 1.1e-02
tuberculosis 1.500 9.0e-08
ulcerative colitis 1.700 2.1e-04
Waldenstrons macroglobulinemia 1.663 4.0e-03

 IMPC Phenotype (1)

Protein-protein Interaction (5)

Gene RIF (16)

AA Sequence

MNPEEQIVTWLISLGVLESPKKTICDPEEFLKSSLKNGVVLCKLINRLMPGSVEKFCLDPQTEADCINNI      1 - 70
NDFLKGCATLQVEIFDPDDLYSGVNFSKVLSTLLAVNKATEDQLSERPCGRSSSLSAANTSQTNPQGAVS     71 - 140
STVSGLQRQSKTVEMTENGSHQLIVKARFNFKQTNEDELSVCKGDIIYVTRVEEGGWWEGTLNGRTGWFP    141 - 210
SNYVREIKSSERPLSPKAVKGFETAPLTKNYYTVVLQNILDTEKEYAKELQSLLVTYLRPLQSNNNLSTV    211 - 280
EVTSLLGNFEEVCTFQQTLCQALEECSKFPENQHKVGGCLLSLMPHFKSMYLAYCANHPSAVNVLTQHSD    281 - 350
ELEQFMENQGASSPGILILTTNLSKPFMRLEKYVTLLQELERHMEDTHPDHQDILKAIVAFKTLMGQCQD    351 - 420
LRKRKQLELQILSEPIQAWEGEDIKNLGNVIFMSQVMVQYGACEEKEERYLMLFSNVLIMLSASPRMSGF    421 - 490
IYQGKIPIAGTVVTRLDEIEGNDCTFEITGNTVERIVVHCNNNQDFQEWLEQLNRLIRGPASCSSLSKTS    491 - 560
SSSCSAHSSFSSTGQPRGPLEPPQIIKPWSLSCLRPAPPLRPSAALGYKERMSYILKESSKSPKTMKKFL    561 - 630
HKRKTERKPSEEEYVIRKSTAALEEDAQILKVIEAYCTSANFQQGHGSSTRKDSIPQVLLPEEEKLIIEE    631 - 700
TRSNGQTIMEEKSLVDTVYALKDEVRELKQENKRMKQCLEEELKSRRDLEKLVRRLLKQTDECIRGESSS    701 - 770
KTSILP                                                                    771 - 776
//

Text Mined References (53)

PMID Year Title