Property Summary

NCBI Gene PubMed Count 45
Grant Count 2
Funding $70,111.33
PubMed Score 39.11
PubTator Score 24.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.663 0.004
astrocytoma 2.000 0.000
psoriasis -1.100 0.000
glioblastoma 1.500 0.011
oligodendroglioma 1.200 0.000
cystic fibrosis 1.338 0.000
medulloblastoma, large-cell -1.700 0.002
acute quadriplegic myopathy -1.052 0.001
tuberculosis 1.500 0.000
non-small cell lung cancer -1.591 0.000
intraductal papillary-mucinous carcinoma... -2.000 0.004
intraductal papillary-mucinous neoplasm ... -2.100 0.005
colon cancer -1.200 0.049
lung cancer -3.200 0.000
lung adenocarcinoma -1.300 0.000
pediatric high grade glioma 1.500 0.000
group 4 medulloblastoma -1.400 0.000
pilocytic astrocytoma 2.500 0.000
subependymal giant cell astrocytoma 1.734 0.011
lung carcinoma -2.000 0.000
Breast cancer -1.500 0.000
ductal carcinoma in situ -1.500 0.000
invasive ductal carcinoma -1.700 0.001
ulcerative colitis 1.700 0.000
ovarian cancer -1.900 0.000

Synonym

Accession Q15052 A6NMW9 A8K6S7 B1AL37 Q15396 Q5JQ66 Q7Z3W1 Q86XH0
Symbols PIXA
COOL2
MRX46
Cool-2
alphaPIX
alpha-PIX

Gene

 Grant Application (2)

PDB

1UJY   1WYR  

Gene RIF (15)

PMID Text
26507661 show that ARHGEF6 is constitutively linked to GIT1, a GAP of Arf family small G proteins, and that ARHGEF6 phosphorylation enables binding of the 14-3-3 adaptor protein to the ARHGEF6/GIT1 complex
26177020 The novel recycling regulator alpha-PIX and the degradation factor c-Cbl closely cooperate in the regulation of EGFR trafficking.
25450678 c-Cbl negatively regulates alphaPix-mediated cell migration and invasion; the lack of c-Cbl in C6 and A172 glioma cells is responsible for their malignant behavior
19969308 These findings suggest that alpha Pix plays an important role in mutant huntingtin aggregation.
19918261 results suggest that low doses of chlorambucil and very low doses of chronic oxidative stress together kill Cbl-resistant ovarian carcinoma cells and ARHGEF6 signaling may have an instrumental role in induction of apoptosis in Cbl(cos) cells.
19911011 Observational study of gene-disease association. (HuGE Navigator)
19672789 The interaction of alphaPix with CagA activates PAK1, ERK and NF-kappaB, which induces IL-8 expression in H. pylori-infected gastric epithelial cells.
17405911 phosphorylation of CagA induces the dephosphorylation of alpha-Pix, which may modulate cytoskeletal changes of gastric epithelial cells through PAK
16897755 PAK4 and alphaPIX can induce highly localized changes in actin dynamics and thereby regulate size and number of podosomes in primary human macrophages.
16320026 Semi-quantitative RT-PCR experiments with 6 of those genes confirmed higher expression of DNCH2, ARHGEF6, NPM1 and SRI and lower expression of NRGN and TM4SF2 in GBM tumors.
More...

AA Sequence

MNPEEQIVTWLISLGVLESPKKTICDPEEFLKSSLKNGVVLCKLINRLMPGSVEKFCLDPQTEADCINNI      1 - 70
NDFLKGCATLQVEIFDPDDLYSGVNFSKVLSTLLAVNKATEDQLSERPCGRSSSLSAANTSQTNPQGAVS     71 - 140
STVSGLQRQSKTVEMTENGSHQLIVKARFNFKQTNEDELSVCKGDIIYVTRVEEGGWWEGTLNGRTGWFP    141 - 210
SNYVREIKSSERPLSPKAVKGFETAPLTKNYYTVVLQNILDTEKEYAKELQSLLVTYLRPLQSNNNLSTV    211 - 280
EVTSLLGNFEEVCTFQQTLCQALEECSKFPENQHKVGGCLLSLMPHFKSMYLAYCANHPSAVNVLTQHSD    281 - 350
ELEQFMENQGASSPGILILTTNLSKPFMRLEKYVTLLQELERHMEDTHPDHQDILKAIVAFKTLMGQCQD    351 - 420
LRKRKQLELQILSEPIQAWEGEDIKNLGNVIFMSQVMVQYGACEEKEERYLMLFSNVLIMLSASPRMSGF    421 - 490
IYQGKIPIAGTVVTRLDEIEGNDCTFEITGNTVERIVVHCNNNQDFQEWLEQLNRLIRGPASCSSLSKTS    491 - 560
SSSCSAHSSFSSTGQPRGPLEPPQIIKPWSLSCLRPAPPLRPSAALGYKERMSYILKESSKSPKTMKKFL    561 - 630
HKRKTERKPSEEEYVIRKSTAALEEDAQILKVIEAYCTSANFQQGHGSSTRKDSIPQVLLPEEEKLIIEE    631 - 700
TRSNGQTIMEEKSLVDTVYALKDEVRELKQENKRMKQCLEEELKSRRDLEKLVRRLLKQTDECIRGESSS    701 - 770
KTSILP                                                                    771 - 776
//

Text Mined References (52)

PMID Year Title
26507661 2015 Cyclic Nucleotide-dependent Protein Kinases Target ARHGAP17 and ARHGEF6 Complexes in Platelets.
26177020 2015 ?PIX Is a Trafficking Regulator that Balances Recycling and Degradation of the Epidermal Growth Factor Receptor.
25450678 2014 c-Cbl regulates ?Pix-mediated cell migration and invasion.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23285027 2012 Bin2 is a membrane sculpting N-BAR protein that influences leucocyte podosomes, motility and phagocytosis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21295525 2011 N-?-acetyltransferase 10 protein suppresses cancer cell metastasis by binding PIX proteins and inhibiting Cdc42/Rac1 activity.
19969308 2010 alpha Pix enhances mutant huntingtin aggregation.
19918261 2010 Gene network analysis of oxidative stress-mediated drug sensitivity in resistant ovarian carcinoma cells.
19911011 2010 Mutation of ARHGAP9 in patients with coronary spastic angina.
More...